SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 44689.DDB_0215009 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  44689.DDB_0215009
Domain Number 1 Region: 1095-1499
Classification Level Classification E-value
Superfamily Ras GEF 6.28e-114
Family Ras GEF 0.00000253
Further Details:      
 
Domain Number 2 Region: 39-185
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.13e-21
Family Calponin-homology domain, CH-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 44689.DDB_0215009
Sequence length 1502
Comment (Dictyostelium discoideum)
Sequence
MNDSTQILDESGDFSFLSLNENKSRSRSTSTCSINSVEIIDGGSCDSSGDDDKNNSYLDE
EKKRILRKTYLYFNANNKKTQLNFIIDNQVLDWIFNQTKTKISKPICESLKNGVALCKII
NLIKPNTIKKINLNSSIFSYRENLTNFTKGCESIGMTEDMSRFQELVFEDKESAVLQLLY
SLMKFSEKILPNTISTSPPSQLNICKSPVLLKKAAAQSSSSSPTTSTSASTSTSTSPSSS
NESIAKPILSALSSSSSTLFSAAPTPTSTNTVPYKFIGHSKSKLFGQQQQQQQQQQQQQQ
QQQQQQQQQQQQQQQQQQQQQQQQQQQQPPPQTSTCTTTQPTTTTTEEHKLAPPPPLIVP
NTSSLPPPQPTTSSIIKKAAPAPLKKPSPANTSSNSLLNHLPPPPSSSSTASSAINTPIS
TPSTSKSNSFQKPNNNFQKPIQIAHVEPIIEENEIEDNTNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNTNDNINNNNKNNNNNQNENEDEVKPVHSPPKVRPPLPSRVGRGQLLRSS
SEEIQFDIENASVSEAPSPVMTMNEDYSIVTDANSLTNHYNGANEYTTTTTAATTNLPNE
SSSRSNSASSNGDQNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNLQLPAKINSEPNNQ
YNTISTSSPSTTGTILESPNGSSIFSQPLNNNNNINNENNNSNNSNSLVTSSSPPLSLPA
YSANGSPNCPQGKKQRSGTKLRSFFGVKSKPESKSVSNFYGVGNSINQPPSNSSPKQSPV
PNNPPSVSQSFLNLSMNSKSSKKKKDNISPDINSNSNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNLEEDENPLTMSNQSANSLKSSGNHFEDDITNGNNNISQNQNQNQNQN
QNQTQNQNQNQNQNHISHSNSISSGNLNNHVNQNNNVNEESVDSELMKALSKVEFLFKDR
KVLKERINFTYPEKYLKFFVNMDELIQIDNSTTFLTESLLSKRPSQQLELCHQEERRFLS
EIVTLQNVLNVVEENKNLITRTEEMQKMIDSLMKEKKELINEKNTLASMLAKTKQQQQQQ
SNDTVSQRKMVDDGIVYNYNHGKYEIKGGTTEKLIELLYNSEFIGSDYFETFLLTYRSFA
SPKRVMDVLTKTYNENYSVEGNATDDVEKRLELDQFNKQRKDTHLKICNFLKRWVEKHFY
DFDQDLLQEFNTFIANCRVINHQDFLQKTLNKKLIPLSSSELKLVFSTPTPAPILPKTPI
TCFEDMDPAEIARQLTLIEFNLFKNIANKEFLSLSWQKQDKEKRSPNLLKMIYRFNEVSN
WVTSTIVKETTNIKKRASYLKRFIKLAEELRKLNNFNGVFVIVSGLHSASVNRLKNTWAE
ISKQQQKQFEEFVALTSPQSSFASYRLELRQSTGASIPYLGVHLSDLTFVEEGNQDKLEN
GYTNFSKCRLIAEQIKAIQEFQQEPYNLREVEEMIPFITHKAVPESECFNLSLICEPRES
VN
Download sequence
Identical sequences Q54TK8
XP_640583.1.73096 44689.DDB_0215009 DDB0215009|DDB_G0281573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]