SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 44689.DDB_0229968 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  44689.DDB_0229968
Domain Number 1 Region: 1363-1661
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.96e-75
Family Protein kinases, catalytic subunit 0.000000647
Further Details:      
 
Domain Number 2 Region: 79-194
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.94e-16
Family Calponin-homology domain, CH-domain 0.0011
Further Details:      
 
Domain Number 3 Region: 1132-1197
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000112
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0067
Further Details:      
 
Domain Number 4 Region: 5-76
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0000654
Family beta-sandwich domain of Sec23/24 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 44689.DDB_0229968
Sequence length 1678
Comment (Dictyostelium discoideum)
Sequence
MSRLQPQQQQRGRSSSFKDNFQIQKPLQSLTPSEQQQQQQQQQQQQQQQQQQQQQQQQQN
NANNNNNNNNNKFNNQYIQQMKNVENDIKKWIGEKCSSSLSDDFLEKDLMESLCTGTILC
VLINMIKQGTIQKIHLQPNYLQRVENIRNYLRACWLFGLHSKYFFPSSYLLSMTIENNDN
SNSSKTTTNNNNNNNNNNNNNNNNNNNNNNNNNNRAIITSPNKNGGVNTMIVNLEYKEKI
MINLTELCKISLKIKNFGSFLQLSSSSSSTPPPPINNNNNNNNNNNNNNNNNNDLLISNN
SSNISSPNSFSDSPMGFSSSINSSSNNSNLNTPNNYNNTNNNNNNNNNNNNNNNNNINNL
TPQMIISSPTSTSSTPPLPPCANNINNNNLKKRTKIPKNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNKIIIKRDCKKVYRKRKSSNCDNDDNGSNSDSDSSDSSDSSDSDSDSLLSSDG
TPIILSQSSNPESVSFKSFIKEILHLKNIISKQDKTITSQKQTIETLEKDLEFQKQLTKK
LLSSPIDLSNFIETSSDPNGAIPVSIQAFTRQIQQIQTLQQQNLSLETELSKTNEHLSTN
IRKNSKLENEVLSIETELLNLRMKYANTLSSSNSNGNNNSNNNSLGCNNSINGSSSGGGG
NNSSTSKGTLSRTISQPFPLRKSISHSNIITSPVNSHQQQQQQNQLSQSQTTSPKNTSAS
YNNGILSKSSIVSNTNTNSTYKFGSSTGILKVSATLQQKQQQQQQQQNQQQQQNQQQQQQ
NQQQQNQQQQNQQKQNQQQQNQQQQQQQQQQQQQNQQQQQQQQQQQQQQQQQQNQQQQQN
NQLSQSQQLQQQQNQQINNLIDSPLIISNSSNQQIESESIESDSDYDKDMVDFGKKIVSA
LISSSNHVEMSEIYKMNDILTNETSRRQICIVLEEETKINQLKLPMNENSFEVTLYLVNT
ILQCIHEAPSKDYFSLKLIMESSRILNRKKVNGSCEFIQEFIKDHPTWKDIKFWEEQYWD
ELIIKHQQFSGSGSSSSSNTGGSIVTTMTTTTTVTSAITSSSSTTSDDFDVDYTELVNTL
LISYVYNLASWGLSKSDVKEFTISMSKKSFLKSNELEKLIEQVTSTVELSFTSDHNVCKG
PHSFVLKSFRIISECNYCRQYIWGVRGIVAREAFECVGCKYKTHKKCLKEASEKTFCSSP
NVGAPFNVKHEMHVGLAIQGLPSGWRTLLLQSGFQDYEIQQHQEDVLDVLEFHHVYNEKQ
QNSIKLLTNNSNNNNNNNNSNNNLQQQQQQNQQLKQKLNITNNQQNNTIININITSPSIS
VNNNTYNNNNNNNNNNEINPSSPNNNNNYYDSLLEIEEPSFTLKDLVSLENPIDLYKVRE
VVGGGSTGKVYVGENSITGEKVAIKKMKVDNNNIKNIINEISTMKNSKHKNVIKYVSSHL
VINHIWLIMEYMSYGSLTDLISNCINIQCNGNNQQQQQQQQQQQTYFIESHIAYICQQVL
QGMDYIHKGHRTHRDIKSDNILLGKDGSVKIADFGFVANLTRKKLQRNSVVGTPYFMAPE
LIRGNQYNHKVDIWSLGILARELSEGEPPYAKYPPVRALFLLTLEGVPDFKEPNKWSSDF
IEFVNLCLNLDDKRRPDAHYLLRHPFLKKACSSREFADKVEEIYNTRKNQFSDINFNF
Download sequence
Identical sequences Q55DD4
DDB0229968|DDB_G0269696 XP_646197.1.73096 44689.DDB_0229968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]