SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 44689.DDB_0232202 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  44689.DDB_0232202
Domain Number 1 Region: 53-336
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.25e-64
Family Calponin-homology domain, CH-domain 0.00000553
Further Details:      
 
Domain Number 2 Region: 662-790,823-883,917-1046
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.14e-43
Family p120GAP domain-like 0.0026
Further Details:      
 
Domain Number 3 Region: 1292-1383
Classification Level Classification E-value
Superfamily RGC domain-like 1.7e-16
Family RGC domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 44689.DDB_0232202
Sequence length 1385
Comment (Dictyostelium discoideum)
Sequence
MTYTDSRYNTLNRGSKKMDPPFITQEVLASAKISKKDNILINANAEDGSVHTFSEEEKVA
YSKFITERLIDQEDVLSNYVPIDPSTDQLFVNCTDGVLLNKLMESLFLTQVNLKGLCIKN
KMNPFEMIQNQNIVIKNAIEVGCIIVNIGAQDLMNATPYLVLGVIWQIIKQGLLSKVNQN
ANEILEILFEEDSVKEVDNTQNQSDEHSAEEILLRWVNYHLEKEGCERRISNFSEDIQDS
VVYSHLFHQLVPIEFENLVSTIHSESNLFSRAELITKACEKIGVKCFLTPSDIALGHPKL
NLALVASLFNSEAAIANLRKEREEKHRTDQERLERERLERERIERERLERERLEQERLER
ERLERERLEKQRQEMERIEQERIELERLERERLEQERLEQERIERERLERERLEQERLEQ
ERLERERLEQERLECERLERERLEQERLEQERLERERIELEELERIERERLEYEERERIE
RERIEREREELEEQERLEYERLEQERIEREEMERIERERIEREEFERLEEERIEREREEA
LRLEAERLERELRERERITRQSELERIEYNKEYKICIRIQKRMIDDTSLTDNMTKLIGDI
TELKRNIIGELRNTTHHQAELKKLTKSIDRVLENKNEGKKLKKQKKVIIKPVKGVPNGLD
PNKMKNYQSLFYYLQTRPEVMGKLLFLLDRNQMGKTFDNLLLSMFPYEISPREEDLFLKA
LTVGIEYQIKYSETLQDFLQSESVPMKLLYQYFKKKGFKYLKEIITPLILKVLDQTDLNL
NFDPYWIQKEIQIAKELKDGKKSEKKTLDQTFEQLMANNDVVSIFNSRCLQLVELGNAFL
ERITKSIEQLPVQLRYLCRIIAEKSKYAFPTNNTNNHHNGGGISSDESGSTTANITLNNN
RSKQLPENREKYISYFLIIYRFIIPIISSPDLLNELVLLQHPYITKQSRFNLSQLSRLIQ
SVFSEKPWMNYFPTVYLNKWIIQNSSSADKFLCQVAQVPDLDELIHYSEYNEIMLENNIK
FCSVINISEIIWLHETILSNFYDLEDIGTLKEVSEKSIQNLAERAINSKLDKGKYVTAAR
QSTPAIMTSQKSQNWPLKKYLDEIDFPIQLPEQGDRSIQLSFINRLDQLNEQSIDLWKEC
KLWMIDILSKSQPPKKNANTIEIIREAIDYFKTGSNSSENLSIINKSNELISRLRTFDRD
QCTDGLDGGGPDNFNLFLLDVEKELATILRKNKVMRSELTRLHSLLKSIRIDAAPLEHLT
KFQNEQLEKAIVKKQLKTTQLTPLPKDKSTIKPHKFILLDLVKKGMILRCELPESSFSKT
KIYIKSLGPGLFEIEAKFGPITKSLQLELDDLLEKSKNHIDEFPLEGITLDVTLTIHLLM
KLFSL
Download sequence
Identical sequences Q552W4
44689.DDB_0232202 DDB0232202|DDB_G0275731 XP_643564.1.73096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]