SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 44689.DDB_0232222 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  44689.DDB_0232222
Domain Number 1 Region: 1098-1185,1228-1544,1595-1709
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.42e-88
Family Calponin-homology domain, CH-domain 0.00000322
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 44689.DDB_0232222
Sequence length 1714
Comment (Dictyostelium discoideum)
Sequence
MSNNKNHHGKGNRNSINSQTSTEKLPQLNNGSNNNLTSILNTSGSPFVKSSSTSTISPFL
MSKHSPPTSPMGIHRFNNSNNNNNNNNVNNIIYNNNNNNSNSNSNNNSNNNNNNFIQNNS
GYFTPTNNNSSSNLKNTLDDTSIKEKIQQLGWMGSPQTASNGRLRSNSMAIGSPGSITFF
QFQLEETNKKLEEKEKDAQLAAEIGKILLERNQELEDQLNTLLESEKKYTDHFSDYDFLK
NQNEILIENLKEATNENEMLIERLKEEEEIQIQNNEKNKKLFMSQQNRSSPNKLEIEKMV
MELEEYKLITKSKDKIITKIKGEKGDLEQKIDELSSGEALIFKELNDEINQLKEKNKSLS
NKYKDLKSISNLNIRKSLLDDFNILKLTFQQNFENNSILSTLFSTNSNSPTTSTTSTSTS
TITTTTSPTITTKNKIFNQEEDIKILLNSKDLLNSLNQNESILNQLIFKLQIIDRVAPQQ
QQQDDENNNILKEKEIEEISNKIGSIQLASSSSNVIKNSNGSPLPSSSSSLLQQQQQQQQ
QQIVSTSSSPTLSISSSSSSTIEGDNSNDYLLRCSILILISIYLSNTLNKLNDSFLKERG
SKCELIEDISELNEKYQNINKINIKLEEKLEESNINLQNITDELNQIKINNVEIENNQNN
QNNQNNDLILKKYYKMKYDKSVIGFSLVIQNLFERINSLELLNQEIIERNKSLHNQMEDI
VCIKDNDISYIKQQCAILEEKAMIETSNSIELKENNSKLIQDLLQHQKNSFEKENQLKDK
YDHELLKSKQQLQHQENQFNSELITIKQQFQIEKQDLQSSIEKQQQQFNNDLECCKIDSS
KLNDQLNQSLQLKDNQIIQLNEQINKFKTKESCLNELIEFSDQEIKRLKNEINLTFEASK
LEQLDAQEKNDELIDELNQKLDTQTLDIQNNLIEIENSKNQLVNQINILQNEKTSIETIF
HEKLIQEQLLLNENQQLKLKLNQFEQQLKEIRELYDQQQLEQQQQFEQQLELQQQQQFEL
QQQKQLEQQQQQQQQQQQQQQQQQQKQQQQQQQQQQSVIEEKVIQTSPPPPPPSTSIITE
NNNNNNNEKVIHKCEILNDENGLAILKYVNKLLGKEIKSGCRECTLSLFSDGLLFCELIN
KFIPESIDSRGLFKVCKSKQDRIDNINVSLNSIKVLGFGTISSTTTTTSNNNNNNNNNNN
NNNNNNNNNNNNSINNNNNNNSTSISFSSEGIMNNYSELISFLLEIFFIGNINKVNLSTH
PELVYLWKHNPEHSISHSKREESWDSFIALEESCLLRRWVNHLLKQDSLDLISGFSIDFQ
KRAILILKTIIKKVYKKLNNENNDNEIESILNNISNNNNNNNSDNEEEIEKLFKFIDSKL
LPNEMIVFKNDFLGGDQQKIIILLSQLLHLNSTIVLSSKDESEIRHNSPDLAPSSEEKAC
KGWLKTMDISTSSFSDDFGDGLLLLKALDKVQPGIVNWKLVNMNPTNTFSMTENCNYCVK
LGKDLKFSLVGIAGRDFVDGIKKFLLSFVWQMMRLSVLKRANHFRSGSGKSQINTSSGSV
GSNGSGTSNSNGGVNGSGGTNSGSGGFNNATLERGNSAPELTESDLVLKINRIVQKSSLS
KQQTTSSHMKSFSDPSLKDGVFLLDLLDSIQPGCIDYQEVQKTDSFESYKSNAQYVITIA
RRLGCTAIIFWEDIVEVKQNMIMTFVCSLLELID
Download sequence
Identical sequences Q55C43
XP_646638.1.73096 44689.DDB_0232222 DDB0232222|DDB_G0270762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]