SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 44689.DDB_0232236 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  44689.DDB_0232236
Domain Number 1 Region: 1-259
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.34e-48
Family Calponin-homology domain, CH-domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 44689.DDB_0232236
Sequence length 457
Comment (Dictyostelium discoideum)
Sequence
AFLSWVNSLLSKKNLKIENISTDFSDGTKLIYFLELVSNKKCRRKFNPEPKDKINRIQNI
TIALWFIEEELDIKIRSISSIGAEDFYDGNKKMIFGFLWSLYRKFRILGIRANGGSGGES
SSSPSSNNHQVSMEQTEAENNLLAWCSNLTGMNVTQFKNGFKDGLAFLSMARQFSQFPSS
TSDLALEGANLRGGVLGSEELSFSQLDGLEGLDSIARLNAVFDFAEKNLNIPKLLDAEDL
VNGNADDRTVMLYTSMFYNAYEMATKKVVSKKEKSENQLLLEQVKELAEQERVNISKEFH
LESMLNMYTQELSNQRFERLVMERMIKEQENQSLLNNLLLLRDQLEDHQIKLCKLQQNVQ
EEATGKRAPLWGCPLISADLSKDQFEQIQLLGDLLEEESNRINRIVQVSEVKPISFLKNK
FQNKNNQIDHDDDDNNNNNNKKNNDDEDDNNNNNTTT
Download sequence
Identical sequences 44689.DDB_0232236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]