SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 44689.DDB_0232246 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  44689.DDB_0232246
Domain Number 1 Region: 1399-1504
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.8e-25
Family Calponin-homology domain, CH-domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 44689.DDB_0232246
Sequence length 1508
Comment (Dictyostelium discoideum)
Sequence
MFRNILSWFDSTPQPPPQQQEQQPEQPLEPPKVVSKNEARILTDQLPAPDSQRSQRYDRI
NNNKNNNNSNVDPLGNKDIFSSSPSTSTTTTTKSSSTTTTTTTSSSSNKQQPLYEDEPPL
IVHELTSKGKRPPSPIFKEESSSQLILDTWEINSSDDESNSKNDFKGFMSQLESSNLNEK
YITSNIYQKYEFFQKRDSEEDLFPSPEPIKKKQSNDLEKNIFDDDDDDDIFKNKQSTVTK
PKQPQQQQKQPIVKKKVEEESLFGDSSLSLDSPLLASKSSPPKSSVNLSPQLFKEDSFDI
DSFLSNDFDFKSKKSNNTTTVKKAVPISKSKPQQPPQKEEIKEVSTQKDNSNSNNNNGWV
SVDEKPKERSTSKSKIGIQKTVTVKSNNSFENDIFGSTTTNDDGGDNDFSFTPATTPSSS
SSTKATTTSPSSTTTTKSNINIGQKSNKSVDQADQFLNDIFQQEEQDKKRREEEAKLKQQ
QKQKEKEQIKDEIDDLFKFSKPTTTTTSTPSKSTTSIVDINSIEKKFSKSAANATTTNND
NNNNNNNTSSPTNKSTNLFNDWEKEEEIKVKEELDKKKKIEQEKKLEQEKKLIEEKKRIA
EEKRISDEILAKKQLAEKLEKERIEKELEDLRLAKELEEKRLLALRQEKELAEKLKRERL
EKEAEDKRIAQEIERKRLEKEKQDQLEKQRKLEQQRLQKEKDEKELADRLEKERIENEIK
EKQKQLEKIKLEKELAEKKEKERLQKEADEKRIADQLEFERLLKLKQEKELAEKLEKERL
EKEAAAEEKRIAAEKLEKQRLEKEAEEKRIAQDLERKRLEKEAEEKRIAQDLERKRLEKE
AEEKRIAAEKLKQQQELAAKLEKERLEKEAEEKRIAQEKRIAEENRIAQEKKIAEELEKK
RLQKEEQDRLAAAELERKRLEKEAEEKRIAQELEKKRLEKEAAEVKRIADEAAAAAKLEK
ERLEKEAEEKRIADEAAAAAKLEKERLEKEAAAAEEKRIADEAAAEAKLEKERLEKEKRI
ADEAAAEAAAALLQQKIEKEKEERDRIAKENKELKEKEDKERKEQRQRERQEKEQERARA
LKEKIEKEKERLNQQKLDQEKEEREREQRERKEQQEREENEKQLEKEREEKERREKLKQR
NEQLEKERQERFKKDQEEKEKQLKEQQQQQKVIIPTTTTTTIRERSNSDSDALLNLPDSA
SSSSHSELVHLTLGRSKAKGRKKPTRRELTKDGNRNKQNIPNLKELKPSTVIIPDDDDDQ
SQKQQSEEVEEKPVAVKKMPIGFNPGMMMPKFDPSAVKLKSSAKPPSTNTTTTTTTAPQQ
PVQFNLKPVALKPTVTQTTTTTTTPPTTPPSSSVQLKPAATRSFSGSSFMGINSTTPTTP
PTTPPSLKKSAAKDAGMKALDVLLQWLKDQTAGYEGVNIKDFTSSWYDGIAYLALVHRFK
PSLIGDWKSFPKNDRVANYKLAFSLAEKHLGVTAFIDADDLAQLPSMERLSNITYLSEFF
KVMKRGGF
Download sequence
Identical sequences Q75JP5
44689.DDB_0232246 DDB0232246|DDB_G0272472 XP_645312.1.73096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]