SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 44689.DDB_0232247 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  44689.DDB_0232247
Domain Number 1 Region: 97-247
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.49e-31
Family Calponin-homology domain, CH-domain 0.00065
Further Details:      
 
Domain Number 2 Region: 1242-1325
Classification Level Classification E-value
Superfamily GAS2 domain-like 2.35e-17
Family GAS2 domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 44689.DDB_0232247
Sequence length 1589
Comment (Dictyostelium discoideum)
Sequence
MARIPEKLVNVENSPLPSTPVDFYGRMKSQRSLISLTEFPPEQSPNQLVQKADEIQSPDK
SSSTSSTSTSTSKDDDSDVDIILFKPKDTNRLTAKRRAWDDYAFLYNREEVRAWLEDIFD
TLFEEEDLFNALVDGIWLCKLVNIIKPGIVKKIHGKKGPSYMKLENINFFLCACLELGVS
SNCLFLPTDLYEKKNLKKVIYCLLALSIQGSKRGFKHKLMITHFNNESSNSSSSSSNNNN
TNTNNNNNNVKVSNNSSTSSLSSLSSSSSSSSSNEKILSKDLNETSILTEEQKDQQQLEN
YLTSQVDIPLPPTLVMRKRKNTIKLRKEKEEKERLEREEQERLERERLEKEENERLEKER
LEKEKQEQEELKKKSTISSFLGIARGLNSKRNSKEITKPYSPSSSTSSSPSSSRPSSGQY
NPIPSFKSDEDEGDDEYEDYDDEEEEEEEEFIESTFDEAFNMMGTFVEEEGDNELFIRDE
TDDIISQLDSEISTEQETEQQQQQQPPQKEEEEKEKEDKEKEILSNQQDQKLELTKELES
ETTDFDTNDESLDSSEVEFQDLSSSVGDININDSEDSLLQSNQQFDEIKNENEKEEVENK
QVEEIEEIEEISIQEILIKDHPMINENENENENENENENENENENEIVNKINEVVNESNN
NTIIVDTEEIKEDVEINEKTQDLIVLENSSSDIEEIEKQSQNDNKTEDEEIIISKNSLMD
IDRNQLETIENLEIISKQENKVNETIQTQSFSQDSSIVENIQSSSSVSSSSTYSMAQLQQ
SESTLIITESSTTTTTKTASSSASITTTSSSISSASSSSSSSLIEEEDIHQQLKIQKEQE
QEQLTQQTKTSNKNNLIGKLIKEQESTIQITSDSFTQEKEISSTSSSSSSSSLAINENKP
EIITEKIELSSLSSTSSSLIESNTTNVNSKKNNDSSIINESASNSKILTYKSSSTSSLSS
ETEEEIIKNNSKIISSTSSSLTNLKATSSSSSSKLKKPLTSGIKAPISTTTLSSPSSSSI
LSTPPTTPQKTYTATTTITTTTITIPPEKSETSPITTPVTTPVSSPSKTPKPSKLQTPTK
KRTLAANVVVEEAKKATMSPSSSSSTPTKSYQTTTTITTTTITTPLPSPTTTPMSSPSKQ
PQPSLLKRPSSSLSNLSNAISNGNSSSTTYKNTEPTTTATTSSTISNIPEDDESPPPMED
LDVDIDISNESNQPKREIIKKDYSYHRSYSSVSNYPKYSSVASDQTDRIFGEFLNNTMKN
ILPPSIVVPNKIVRLSANKYKWGDSIVNMRCVNNMIVVRVGGGWMTLKDFLIRYNSVITA
SDIDKINQSQDDSNNNNNSNNNNNNDEMKKLQIQKNYKTNSGEIKTSQPLSPIKGNVIKA
TKNINFPSSTLRSGTPAPYSRSPSSILRSGTPAPPELDDKEDTNSVQYKLGVHRTNVSSG
TLRTVVSNTPSPTRSSSSIGGQRTINKPTTTTTSNTTSNLKSPSSSIGGSRLSSTPSSSP
MKPKTPSSSSTPPTSSIKSPINRPSSAAGISSPSRTTPTTSTTTTTTTTTPTSKFITTRP
SSAALPSRPTTSSTTPTKTTTTTTKPLKK
Download sequence
Identical sequences Q54I34
XP_636437.1.73096 DDB0232247|DDB_G0289033 44689.DDB_0232247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]