SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 44689.DDB_0233173 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  44689.DDB_0233173
Domain Number 1 Region: 615-865
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.1e-54
Family DBL homology domain (DH-domain) 0.0000749
Further Details:      
 
Domain Number 2 Region: 339-604
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.03e-51
Family Calponin-homology domain, CH-domain 0.00037
Further Details:      
 
Domain Number 3 Region: 118-272
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.09e-32
Family Calponin-homology domain, CH-domain 0.00054
Further Details:      
 
Domain Number 4 Region: 853-942,994-1026
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000465
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 44689.DDB_0233173
Sequence length 1198
Comment (Dictyostelium discoideum)
Sequence
MFSNFFGSSKRNTIASSSSSSKKDKDNGKDESSKLKNSGSSTLPKPITNNESGNNFITSP
SVSSPLISPLSSSPSPLLSSSSNSIQSTSHQQQQQHQGVITSLQMKPSCTSLTDDIEKKK
QAKYDSSLEQTARKWVCDVLEIQLEDDKTFYELFKNGVLLCRLINKLRGGTIKRINESTI
SFKQLENIENYLKACKTLGLQSVNLFNSIDLHENKDISLVITNIVVLGKHASKIEGYNGI
HLAGERKIIKITTTPVSPLFGGNHNNNNNNNNNNNTSNGDLSPVSITSASGGSSNYNSYS
NNPLNKSSNGKKAKWRKSVKIPAVSSLNSDIRTKEAFKFSPELQKAAQDWIEEVTKEKFK
LPSFSSSLKDGILLCRVINTIIPNTILYINNGNSSFKKMENIGNYLKGCLVVGLKKTDLF
DTPDLFEEKNINFVISNIHVLGNHVNKMYSHLKLPLIKNIGNGGNGGNGGIGGGGGSDGS
PLKMYSSIIHSKFGNGSSNTSSGNGGVIIPPEDMKDLKDWINHHLRAHHSLQIGSDMSND
LRNGVTLLTLLEELTLQKVGIFAREPVLPWHFMQNICLLLNFLRENSVHNVSDISPHDLF
NGDIHSLCMITRLIRENFDTDHQMKSIPMDTRRQKVIEEIIATEQSYVKSLSTVYNLLIV
PLLNSLDTNSPILSNDEISSIFGNWEHLLRSHINLLKEFKLKLNLPFNDLTIDDSNQNQN
HNNIFGDSIFDSNITIGDVFLEKCEFLKDNYTNYINNYDNSYQRVKRLKKSNSNFEELVN
TFEIFQDTHNGLDLYSYLIMPIQRIVRYILLLKEVIKYTPSTHPDYQMLQNAKENIKRVA
DHVNESKMAVENKRKILSIQDSIQNLQFNLMDKERTYIREGFLEIEDTFKKDSYFFLFSD
LLLFVKYKPSEETGKEFKYKEVFYLDQVVDVSDILSDDEGEACVDGDDDGGEYEGGNGDA
TSGSADPEDQTLRRSCNSNNNNNSNSNKSNTVYSFEIETCEFSLVLLAESHTEKIEWMED
LRSCLQHQLIKEEDQLSSLSLSDNDDDNDADADVESSLNSISSPLLLLNNNNIINNNNNN
NNNNNNNNNNNNNNNNCKNSNININSSIDNNSDNNNNDYDSKINSEENGDSSDEENKTSN
RRSVSFKTHKRLESDETISDTESDDYELVCGRSKKSQPPPVPPRKITFSDTIKNIDNQ
Download sequence
Identical sequences Q55E26
XP_645955.1.73096 44689.DDB_0233173 DDB0233173|DDB_G0269424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]