SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 44689.DDB_0233182 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  44689.DDB_0233182
Domain Number 1 Region: 336-543
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.02e-52
Family DBL homology domain (DH-domain) 0.00031
Further Details:      
 
Domain Number 2 Region: 42-148
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.62e-22
Family Calponin-homology domain, CH-domain 0.0011
Further Details:      
 
Domain Number 3 Region: 537-623,826-860
Classification Level Classification E-value
Superfamily PH domain-like 2.96e-16
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 44689.DDB_0233182
Sequence length 1096
Comment (Dictyostelium discoideum)
Sequence
MENNNSNNNNNNNLSTLRKSNINGGNSNIVQSCLSFLHRSLSIKKWIEKILGEKLSEDHH
DDNDGLLLFGKLMNGVVLCKLMSCLKSNSIPKIHTGESILNFKIRENLCFYIQALEDIGI
SRHFQFQVPDLLEKKNLLKVLESLEVLADDCTDFEKPIELSDEESLLIQFTDKQLSDTEQ
ILKKLNVTHIKRQSLKKLTSNEPKRFTTSGTTLSHSTGSRLTFGGGSSNSSTGNSNGSSS
GGGSSLSHSGGAPHSSSTPSSLSSSSNGGSGLTQSGGGSRTFQTRIVSTPANVKPKAPLS
VAQILDKARPFEKRWIKIQAFFRGHLARKAYQKRVRFAAYRHNIVKELLATEQVYIDSLD
HVVAHYFNPMREESSKLNIKLDHFGLLISNLEVIINYNKNLLQNIKPKVENWSHSQTIGD
IFEQFTLYLKVYTQYVKEYSIFFEAINNLRKSNTKFESFIVEKEYNDNYKSIGTYLILPI
QRIPRYTLLLTELLKNTWSDHLDYNNLQLSLKKMQEVALYVNEKKREAENIAKVTEIQNN
FIGKFENLAEPHRRFVFEGHLSVIGPGGKESQRVVYLFNDVLISTKPITSGLVKKKVSLK
VKESIRMNLVTIKSKSNNNNNNNIENSENNNNNNSNNNIANNNTPTKISSTPKSSSASSL
LSNSTPSSPSPSTTNTTTNTPQPTPTPISLSSSMPSQPTKPTTLKPVPPPRSQATFNVTS
PTPNPTTTNPTTTNPTTTNPTTTTTTTTNKPTIGVKTSSSSITISSTNKEVVESTKPRSS
TTVVNNSTNINIHNQIRQPTPIASVTASSSQERLIIEEKMKKQNQTIELIDTFGTCVLKL
LCSSVKEKDQWVSEIKKVYEDLDNKKIINDEAMKRSQERAGLAKAALSQQYATLRVKGRL
CDLNTLKTSINQEEDGSNNSNSNNSSINNSPTTSSPIVNSVNGSGSGSGGGGGSEQQDGS
TSNTTNTSGEREFNVLRRQTLSARRSQNNATPPPPQSQSTTTANTNTTTTNDSASDHSDT
DEKKNEKSHSKTGTGWFSSLRKKKKHPSIQDTFGLDTSPITPSDIKSSTSTTTPPTSTST
STPPQSNTVILKQDNL
Download sequence
Identical sequences Q86K95
44689.DDB_0233182 XP_642805.1.73096 DDB0233182|DDB_G0277131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]