SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 44689.DDB_0233183 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  44689.DDB_0233183
Domain Number 1 Region: 459-657
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-54
Family DBL homology domain (DH-domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 13-151
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.9e-31
Family Calponin-homology domain, CH-domain 0.00035
Further Details:      
 
Domain Number 3 Region: 946-1049
Classification Level Classification E-value
Superfamily PH domain-like 2.52e-16
Family Pleckstrin-homology domain (PH domain) 0.0053
Further Details:      
 
Domain Number 4 Region: 647-763
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000191
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 44689.DDB_0233183
Sequence length 1316
Comment (Dictyostelium discoideum)
Sequence
MQPKDYMSSSHANWENIQIDSFTSWINQHLSERGLSVKDLSVDFQDGVLLLNLLEILSGK
KIARYVRSPKFLQHKIDNIMIAFNFMEKAFDIKVFGCNAKDIVDGNLKQTMGVIFLLIQK
IKVNLHLDHLQEQQGETTGTTTTITSTNTTTTPTKPRFYRASMQVNAANRFSHISPNKDQ
SSSTVATTTTTSTSVVQPQPQPTTATPTTTTATTLTPPVASQQPVSTAPATVTPSTVIPT
VTPLNTTTTTTTATSTSTNVPTATTNVPPTATTTTTGTRISPTTGVSVSTIRSKFLFEGG
TGNTTGGNEKYNTYSPGSGNTSGVVGPSTSSSLNISSERVLKRTESGYLISGGLSLSGSG
SGGIHEPLQRTVSLIEIKLNDHQSKFYDLKKIIFMQSVIRGYLVRSKWRNVLEKYKQHLN
EYKKHFMNNKKAYRGLIRVQAIVKGKIQRKKLFKMFPLYRRNEIVKEILSTEDKYVTSLA
MVTTHYLKPSEAFLSTQQVRSIFSQIEIIHRYNSLILEKLVSRNKIWYSSGQKIGDIFIE
MSAFLKVYTIYVNNYNNSIQTITECMEIPKFASLLEKNRNQFGLDLSAFLIAPIQRIPRY
ILLLQDLLKNTKESHPDHQDLSLALKKMKDVAEYVNEKKREAENLNQVLTIQSSLTGKFN
NLAEPHRRYVKKGTLISNDKIHLYFLFNDLLVKTENKIVSKIRDSARLSNNNSSDKNSKS
TFHSPKEIINEGKSKYLNSYFLAGSSLVDSNPDGFTFQIIGVGDANELNSQINNQINNQN
NNQNNNQNNNLNNNNDDSPILSFSPFSSSFASTITNSLSSIGNSNNVNNNNNTSSNSGFV
NSSNNNINIVNSNGSSPLTNSGHGLNSSFGISSNNNNNLTMPTTSIQLEALSLNEKMTWM
GELDECIFQLLEKSKSKKRSLITDADELTTVPFDISVVKDSEFSNVLEKKHSEISWRSKK
FYLKNTHLYYHRYSSTESPKEPTKIKCINLILCSVKLAQVVDHPHCFQLITPSRIYFFSC
EDSTVLFQWISLIRLSIKKKLESLKDENNNINNFTSIASATSPTSSSSNTTPIVVPIASH
SNATGSLSASLGSSFLNQQQRSLEQQQHLNTSNSNLTPLALSSQVLYHINNFISTSTSTS
ASQSQSQSPSPSPSHSINQKQKIRKLSFYQSRSNTLININNDEDRLNSFPTSTLSVSCLL
NNDNHGNNDFDGKSFTNNIDITTTTTTNDDNNNNTTTTQVKKGKDLSCSKELNCSISHDD
NSKGSSGYGNNSCGDNINNDESLAQKNFNSIISFFLSTKKFIKSPKRTISTSFLFS
Download sequence
Identical sequences 44689.DDB_0233183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]