SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 44689.DDB_0233317 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  44689.DDB_0233317
Domain Number 1 Region: 350-576
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.72e-58
Family DBL homology domain (DH-domain) 0.00019
Further Details:      
 
Domain Number 2 Region: 8-151
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.71e-24
Family Calponin-homology domain, CH-domain 0.0016
Further Details:      
 
Domain Number 3 Region: 811-920
Classification Level Classification E-value
Superfamily PX domain 1.02e-23
Family PX domain 0.0015
Further Details:      
 
Domain Number 4 Region: 564-693
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000162
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 5 Region: 935-975
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000000706
Family beta-sandwich domain of Sec23/24 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 44689.DDB_0233317
Sequence length 1069
Comment (Dictyostelium discoideum)
Sequence
MNSSKEIQWAQTILKQKQIAINSIDDFRDSVLLIELLQIITNKTITKYFKKPKNRFQSIE
NASIALNFMKDNSFQITTFYSPQDLADGNEKSIKSIIYIIYLYGHGKPLRLKRIRRNTIV
NNRKVLLETSFSSPDLNNFSEEEEDIEEDDDDDEEEIQLESIHDDDGDTTSESDIGESLK
KSFSTASISSETDGNGINSSTEKLSPPTSPTISPTFATFWRKESLKSQLSSSLGSNGGSR
RFSGAFTNRSTINIKNIQNNQMSNSIGSLPIVPLPSNGDGGDSGGGGGNGSGSSTPTQGW
FKSVKTEDSNKKKSIKKVPLLVKISAPDFERYNNVEFLGAIINCQRFIRGWMSRRILKQR
KKFNSHRNKCFNEIITSEESYVQCVEMIVKVFYQQIMWNNKVSPSPYLKLEDINTIFSTI
NQIYSFNTELLTQLKKVADTWSHYQTVGNVFNSMVHYMKLYKTYCLNYDSAILCLQKAKK
NQTFNLFIKACLDHPENKMKQSLESLLITVVQRIPRYIMLINDLLSHTWKDHPDYQNLQT
ALNMVQTVASEVNRSIKTAESQSRVLEIQKSLIGWSEENNSELVQPTRLFLKQGVILDCQ
LDTRFSKDLQQMVYFLFNNAILITGKEDSSHCFKFKYFFDLTDPSTKLKDIDDNQVIKNA
FQLILGKTMAFLATESLSEKQYLLNHIQTNCKTKITRPSTLILDSNNNNLNNSSSTLLLN
SSSSTLTFSNSLLPQLPPQQSNETSTTTTTTTNTPSSITTNTPSSTNQELEQQLQTENLD
NNNNNDNNNNLDDNNNDNLVCEEILKSFDSDKNYTVSILGTTNLKEAGKKEYTVYNICIT
NDETGETINITKRYSEFDYLNKKMKKKFPNQEIKELPKKHFINSLGTTTVESRRLMLEIY
LQQLFQIEIVRKSQQLRNFIASVSNKENITDNDNIQDLQQQQQQQQQQQQQQQQQQQQQQ
QQQQQQQQQTSHSSFEPFLKKLKENQLLKREKSSEKSLDKVLKKEKSTDKNLDKSSSLKK
EKSDRILKKEKSTDKNLDKLKKKEIDGTITTTITTTTDQITPDTNSSSN
Download sequence
Identical sequences Q54S15
DDB0233317|DDB_G0282717 XP_640224.1.73096 44689.DDB_0233317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]