SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 44689.DDB_0233391 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  44689.DDB_0233391
Domain Number 1 Region: 180-291
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.28e-25
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000645
Further Details:      
 
Weak hits

Sequence:  44689.DDB_0233391
Domain Number - Region: 298-331
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000251
Family Retrovirus zinc finger-like domains 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 44689.DDB_0233391
Sequence length 501
Comment (Dictyostelium discoideum)
Sequence
MSPNDVEQQQLPTQNNNYNDNINSPSLNDDDEDSFFREIKEISRGRPKTRDEIQISDRTR
LSRWDTPLTNDGVSPFSSIFKTLPPGLTDEQIAALILRLRVDEITKKITIGPIEFTERDR
ERSPSPPPTYDNNGKRSNTREQRIKEKLQKERHQLVVTAQQINPTYKPPSDYQPPNEKKT
RKIYIPIKNHPEYNFIGLIIGPRGNTQKRMEKESGAKIAIRGKGSSRDGKPTKLQFQEND
ELHVLLTADTVDQLDKAEVLVREFLIPVEEGKNEHKRQQLRELAEMNGTLRERPAYMGNR
SWTPVDIKCVQCGETSHPSSDCPLRSNESNQQYIESEYQKFIDEMSKSLGFDISISPNQN
DNSLQNINLNNNNNNSNGNNNGNNNGRNFNNDTVGDMDESPPHHTQSHFQQNSPQFDQQQ
HQQQWNNNNNNNNNNNHNNNNNNNNNNNNNNNNNNNNNNNNNNNNNFSNYNNNNQSFYNN
NNSPYGPPNGGSPYGPPRNTY
Download sequence
Identical sequences Q54BM5
DDB0233391|DDB_G0293554 XP_629004.1.73096 44689.DDB_0233391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]