SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 448385.sce7131 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  448385.sce7131
Domain Number 1 Region: 138-220
Classification Level Classification E-value
Superfamily S13-like H2TH domain 3.53e-16
Family Middle domain of MutM-like DNA repair proteins 0.023
Further Details:      
 
Domain Number 2 Region: 232-272
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000884
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.011
Further Details:      
 
Domain Number 3 Region: 2-142
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 0.00000000157
Family N-terminal domain of MutM-like DNA repair proteins 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 448385.sce7131
Sequence length 290
Comment (Sorangium cellulosum So ce 56 )
Sequence
MPERPDLEYVVPILARELAGAAVAAARAENSVVLHVLLPERLDALLPGAEIRRVARRAHA
VVFELDGARALDLVISPMLAGRFSITRPGETRIPTDLAFSLTLGDGRELRVRDDVQMSKV
YVLARGDFDRLPGLQRVGLDVLDPRVFTQEAFRSAARGRRDLAKDFLMDGTALDSMGDSY
ADEVLFEARIHPKATVQSLSEEETDRLHAAIARVLGDATRTIARRAPALDERLRDFLKVR
GRPGQPCPRCGDKLRRASVHGHDAIFCPACQPEARRSAAGDPRRARREPG
Download sequence
Identical sequences A9ERJ1
WP_012239739.1.90317 gi|162455413|ref|YP_001617780.1| 448385.sce7131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]