SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 448385.sce7804 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  448385.sce7804
Domain Number - Region: 48-122
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 0.00471
Family TonB 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 448385.sce7804
Sequence length 128
Comment (Sorangium cellulosum So ce 56 )
Sequence
MKQLFSGLTMMVLAIACAGCSFAVRNAEMYRDDTAALLETRRDEISACYDAELARNPRAQ
GKVTVAFTVLEDSGRITDVAVDPAGTTASDDVASCVVKSIDGLVLTPPDERQGKGKFVWE
FTVGAPKA
Download sequence
Identical sequences A9FB38
gi|162456086|ref|YP_001618453.1| 448385.sce7804 WP_012240412.1.90317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]