SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 449447.MAE_01000 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  449447.MAE_01000
Domain Number 1 Region: 1233-1348
Classification Level Classification E-value
Superfamily CalX-like 1.02e-29
Family CalX-beta domain 0.00059
Further Details:      
 
Domain Number 2 Region: 164-466
Classification Level Classification E-value
Superfamily Pectin lyase-like 5.89e-28
Family Galacturonase 0.078
Further Details:      
 
Domain Number 3 Region: 1465-1570
Classification Level Classification E-value
Superfamily CalX-like 5.23e-24
Family CalX-beta domain 0.0032
Further Details:      
 
Domain Number 4 Region: 438-666
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.26e-19
Family Galacturonase 0.039
Further Details:      
 
Domain Number 5 Region: 1349-1462
Classification Level Classification E-value
Superfamily CalX-like 1.7e-18
Family CalX-beta domain 0.0034
Further Details:      
 
Domain Number 6 Region: 873-998
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.000000000000355
Family Haloperoxidase 0.035
Further Details:      
 
Domain Number 7 Region: 663-753
Classification Level Classification E-value
Superfamily CalX-like 0.0000000000458
Family CalX-beta domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 449447.MAE_01000
Sequence length 1763
Comment (Microcystis aeruginosa NIES 843)
Sequence
MTSTLLPLLPAVDDVLFDFAQSDGFWANLETAFGTSYDVVKATELRQQWQSRDFSQLPEI
EVVNSSVLGSANGAYGISTNKIYLSESFFASASLDALVAVILEEIGHYVDAQINRVDTVG
DEGELFSHLVRGVNLTEAELTYIQTEDDRSVINLGGQFIGVEQTSPITLIVNTTIDENDG
SATIGSGLSLRDAVTIANKSPNTPYIIKLKSGTTYALTYVNNTTTGDRSLNTNGTITIET
DGTALASIVNNASPISGENDYNSIISNSSQLGVTLNNLYISNKAGRGIDNDYGGTLTLNN
STITGNTATYGGGIDNDGTLTLTNSTISGNTGGGIHNWGRGILTLTNSTITGNTATNFGG
GIENDGTLTLTNSTITGNTATYSGGGIYNWGRGTLTLTNSTISGNTATGYYGSGGGIYNS
TGTLTITDSAISGNTATGSGGGIENYGTLTLTDSTVSGNTAAYDGGGIDNYGGTLTLTNS
TISGNTATGSGGGIENYGTLTLTESTVSGNTAAYDGGGIDNDGGTLTLTNSTIFGNTATR
SGGGIFNSTGTLTITNSTITGNTADAGGGIYNGGTLTLTNNILTNNNANLGGGIYNRGTW
SSNSIISGHTANQVWYIDSDGDSTTSESSWINGQWIANPIDPKYPNIYDDATYTALPPTP
NPPPKPTISVSNARFDAPAGKVIFEVKLSSTYDKPITVDYYTLDGSANSIDPNQLKDFNN
VVKQTLSFFPGQTSKQIEITVLGSAPPTDQTFEILARDTAYRDWTDTDKGKEVDKIYDYS
DLGYEGYRINKVFKDSSTGFDAFGLTSDEKFFLVLANPLNANEFTSNSNNLLQDIANTSG
GNNTAAYTAGQNLINQLTSANQSYTFTDGTIYDLAKPPVLAIRGTEFSSGKDLLSDTETE
GVGYNQFTNNKAAINQWLSEVSNPVSGLTLKPNITGHSLGGALSQWVGGSYTGQLGKIVT
FNSPGISQQPGINFNATNNLGVTHYITSADVVSIAGSTYLNGLWNLEKYSKLTSAITFEK
HSVPVLNQTITRTNLSKPTDLTRKVANGNTTDLSSYWFTYLPDADYFALQMMIRGLGSLP
IPGIGLTGTYLAAALTYRGTTEKVRQAIGIAIDGLGNISDAVTSAYNAAKSWTSDAWDAI
IGQSDKKLGLSPSTANQSNSTQTLASSFLDTNSYQIATTATASQTIDNFWDAIPDWGDNA
WQATTKWSGDAWNSIDEWTPQTWQATTTWTAADWDKPFFTISNPTIVENNSGTNNLVFKV
TLSTTSTQTITVNYATADDTATAGSDYTATTGTLTFTPGQTSQDIIISVNGDTAIEPDET
FLINLSNPSNALITDNQGLGTITNDDGDNTSVTLAVSPSSVTEDGTANLVYTFTRTGVTT
NALTVNYTLGGTATLNTDYTRTGTNNTVTFAAGSDTATVTIDPTADTNVEDDETVTLNLA
PGTGYTIGTATAVTGTITNDDFSKLSINNVTVVEGKDNNAILTVTVNNPNPQPISVNYTT
APINAIANVDYTSKTGTITIAPNTSTATITIPILNDNLNEANETFAINLSNPVNATLSNN
KGIVTISDTLTANVTTTLPANVENLRLIGSNNINGTGNAGNNKITGNSGNNQINGRAGID
TLTGGLGADTFIFQFGQSTISTRDRITDFAINSDKIDLLTQAGNATSAPSNFSRAANSTV
TTLQNLINQVFTDANGATTGNQGLGVNSAALVQVTTGAIAGTYLVINDSTAGFQSSNDLL
INITGFTGTLPALGNIPVGNFFV
Download sequence
Identical sequences B0JFG0
WP_012263848.1.4043 gi|166362841|ref|YP_001655114.1| 449447.MAE_01000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]