SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 452471.Aasi_0013 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  452471.Aasi_0013
Domain Number 1 Region: 301-495
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.06e-46
Family Ribonuclease PH domain 1-like 0.000055
Further Details:      
 
Domain Number 2 Region: 14-146
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.39e-43
Family Ribonuclease PH domain 1-like 0.0000986
Further Details:      
 
Domain Number 3 Region: 147-237
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 9.26e-24
Family Ribonuclease PH domain 2-like 0.00095
Further Details:      
 
Domain Number 4 Region: 456-555
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 9.4e-24
Family Ribonuclease PH domain 2-like 0.00016
Further Details:      
 
Domain Number 5 Region: 619-707
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.29e-22
Family Cold shock DNA-binding domain-like 0.0008
Further Details:      
 
Domain Number 6 Region: 240-331
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.57e-19
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0048
Further Details:      
 
Domain Number 7 Region: 561-640
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000013
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 452471.Aasi_0013
Sequence length 713
Comment (Candidatus Amoebophilus asiaticus 5a2)
Sequence
MLNKIISKTISLPEHREITIETGKLAKQADGSVVVRMGDTMLLATVVFKQELDPTVDFLP
LHVEYQEKFAAAGKIPGGFLRREGKLGDHEVLISRLVDRAIRPLFPDNYKHETQINIFLI
SADPEILPESLAGLAASAALMISPIPFEGPISEVRVARIDGQFVVNPTQSALEKADIDLM
VGGSEKNILMVEGEMDEVQEADIIAAIQFAHEAIKLQCQVQKELADAVATLKFEAEPLQE
TENFELKDRTFKALYDKVYATAKKGITNKHLRKSSFKQIKKEYLKELLQQDPETSTVHFD
KYYYELEKQVVRDLALNEGLRLDGRKLDEIRAIESEIDYLPAAHGSSLFTRGETQSLTTV
TLGTKLDEQLIDRALLNGYSRFMLHYNFPSFSTGEVKFNRGPGRREIGHGHLAMRALKKV
LPLDTENPYTIRIVSDILESNGSSSMATVCAGSLALMDAGISIRSAVSGIAMGLLMDEQT
GKHAILSDILGDEDALGDMDFKVAGTAKGITACQMDIKVSGLTPQLLQKALEQAKAGRLH
ILGEMNKTITEPKTTYKKHAPSFSTMTIPKNMIGAVIGPSGKIVQEMQRETGTTIIIEEV
EGKGIIKFFGPNQEAVQSAEKRVKDIVAEPVVGDVYQGTVKSIVPFGAFVEFMPGKEGLL
HISEVKWERIENLDQVLELGEVIPVKLLEIDPKSGKYKLSRKVLLPNPKATEA
Download sequence
Identical sequences B3EU51
WP_012472242.1.36742 gi|189501482|ref|YP_001957199.1| 452471.Aasi_0013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]