SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 452471.Aasi_1070 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  452471.Aasi_1070
Domain Number - Region: 60-142,186-244
Classification Level Classification E-value
Superfamily t-snare proteins 0.00306
Family t-snare proteins 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 452471.Aasi_1070
Sequence length 274
Comment (Candidatus Amoebophilus asiaticus 5a2)
Sequence
MIEKSIAIYSFIDTLLKYLHHQEDKKRKLSDAEVLTTAIISALYFGGHLDKARSFMHSTK
LIPNMLDKSRYNRRLHAIGEEITSLFLEIGTLIKQVATCKDFVLDSFPVPVCDNIRISRC
KLLQSEAYRGYKASMRRYFYGIKVQLITTDCGIPVEFSIVAGSQADVKGLHQLPFSMPAG
SALYADSAYTNYHLEDMLADDRIKLYSQRKSNAHRKDTPSLAYLKERMRKVIETSISGIK
GLFLRKIHAVTFQGFLIKILLFLLAFQINKAFLN
Download sequence
Identical sequences B3ERD7
WP_012472346.1.36742 gi|189501587|ref|YP_001957304.1| gi|189501592|ref|YP_001957309.1| gi|189501801|ref|YP_001957518.1| gi|189502427|ref|YP_001958144.1| 452471.Aasi_0128 452471.Aasi_0134 452471.Aasi_0366 452471.Aasi_1070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]