SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI100701 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI100701
Domain Number 1 Region: 4-62
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000000924
Family Calponin-homology domain, CH-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI100701
Sequence length 66
Comment (Nematostella vectensis)
Sequence
HRNFEQLCKDDHAKNNGLAFSIAERELGIPALLDVCDVTDLKVPDEKSMATYISLFYQRF
KDHQPS
Download sequence
Identical sequences A7S1B7
45351.JGI100701 XP_001634493.1.94760 jgi|Nemve1|100701|e_gw.58.291.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]