SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI106413 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI106413
Domain Number 1 Region: 26-152
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000675
Family Growth factor receptor domain 0.009
Further Details:      
 
Domain Number 2 Region: 2-37
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000876
Family EGF-type module 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI106413
Sequence length 169
Comment (Nematostella vectensis)
Sequence
SECFKKPCQHGGICKALFEKNDYECICLQGHTGKRCEKEINKCESSPCKNGGNCTDQVNN
YICTCQPGYTGRNCEKEHNDCESCPCKNGGSCTDRFNDYTCKCQPGYTGKNCEIDIDECA
GNPCKNKGKCIDHVNNYTCRCQAGVSGRNCEKGIQEKSSVFMTHRKEKC
Download sequence
Identical sequences A7S6D2
jgi|Nemve1|106413|e_gw.81.97.1 XP_001632793.1.94760 45351.JGI106413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]