SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI115638 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI115638
Domain Number 1 Region: 1-213
Classification Level Classification E-value
Superfamily Kelch motif 5.36e-59
Family Kelch motif 0.0000374
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI115638
Sequence length 214
Comment (Nematostella vectensis)
Sequence
MFVIGGETHNQVYNSVQRYDFETEKWDFLEPMCKRRDGVGVASYAGRIYAAGGCDGDVAL
SSMECYDPIGNKWSFVQPMVCGRHAFSLVELDGWLYAAGGSDFSRSEYSSVERYDPIRDM
WSSVTAMSTMREGVSMVTMDGALYAIGGDNGVTILNTMERYDPRIGQWSACVHMGYRRRY
FGAVVLKNKIIVIGGSDYDEDHNSVECYNPRMNR
Download sequence
Identical sequences A7SES4
XP_001629818.1.94760 jgi|Nemve1|115638|e_gw.133.177.1 45351.JGI115638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]