SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI119917 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI119917
Domain Number 1 Region: 105-160
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000327
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 2 Region: 281-333
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000353
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 3 Region: 220-278
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000589
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 4 Region: 30-100
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000327
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 
Domain Number 5 Region: 160-218
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000759
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI119917
Sequence length 381
Comment (Nematostella vectensis)
Sequence
FYQCIRSIDNVRVQDSLCTEIVAKPDRRKVCNIQPCPARWVPGEWKKCGKTCGTGIQLRN
LYCRQKMDVDGRQVDRKVEINNCPQWSRPKVTRPCQLPPCPPPNEWKTGPWRQCSVTCGT
GIETRTVECMDVEQNITQEESACAEKPKPHTTRRCNPGGCKTHWFIGSSFTSCSVTCGYG
VKERLVFCGRQGGDALPDSQCESRYRPRSTQRCREKRCQASWVTSEWSKCSANCGQGKQT
RIVFCTNEVRNVHQQVPIYNCRHSPQPESERNCTIKECAPEWFVTSWQKCSTTCGGGSQH
RIVMCLNDQGKRVGGCEVSKKPLHWQRCNTQNCPRSRWRRPDKSKDSCKDESKGMCMIVV
QARFCTIKSYRERCCESCKNL
Download sequence
Identical sequences A7SIR2
XP_001628462.1.94760 45351.JGI119917 jgi|Nemve1|119917|e_gw.165.43.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]