SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI121810 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI121810
Domain Number 1 Region: 6-112
Classification Level Classification E-value
Superfamily SH2 domain 1.06e-26
Family SH2 domain 0.0000348
Further Details:      
 
Domain Number 2 Region: 117-154
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000222
Family SOCS box-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI121810
Sequence length 155
Comment (Nematostella vectensis)
Sequence
EYYFIRDLLEITNCPWYWGKINRFEAERVLDGLPDGTFLLRDSAQYQYLFSVSFRRYFRT
YHARIEQWKHRYSFDKPSDYSFCSKTLHELLQHYSQAEQCMYYEPLLLNALPRKNTLPLQ
HLCRATICKNVSFQDVDELPIPKSLQTFLREYHYK
Download sequence
Identical sequences A7SKN8
jgi|Nemve1|121810|e_gw.183.45.1 45351.JGI121810 XP_001647528.1.94760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]