SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI125072 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI125072
Domain Number 1 Region: 158-226
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.95e-21
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 2 Region: 42-110
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.25e-17
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 3 Region: 100-162
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.01e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 215-269
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000107
Family Complement control module/SCR domain 0.00088
Further Details:      
 
Domain Number 5 Region: 3-52
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000584
Family Complement control module/SCR domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI125072
Sequence length 272
Comment (Nematostella vectensis)
Sequence
TSLDSDVHITCNDGFRLVGSATRTCQSDGLWSGLQPSCVAAACPDPVAPAKGLVVGLQRS
VGDTVRFECQEGYRVSGKAYSVCQSSGSWDSPTPTCAIVDCGKPPALASGSIVGSVYTYG
SKIQYRCIQDWHLSGPAERVCQADGLWSGKAPVCLERSCGNPGNLANGKRTGEDFTYGKV
VTFTCNSGHVMSGSSTRTCQTNGKWTGTQPTCDPAICGDPGAPVNGEKTGAFTYGSTLTY
DCMPGYKLVGDRQRTCQANAQWTGSQPHCTGE
Download sequence
Identical sequences A7SNM5
XP_001626801.1.94760 jgi|Nemve1|125072|e_gw.216.84.1 45351.JGI125072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]