SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI130690 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI130690
Domain Number 1 Region: 8-82
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000025
Family RING finger domain, C3HC4 0.022
Further Details:      
 
Domain Number 2 Region: 151-188
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000103
Family B-box zinc-binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI130690
Sequence length 188
Comment (Nematostella vectensis)
Sequence
MATSASRRLEDEVTCSLCIEHFNDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCKAE
FQISPADVSSLKVNFMINSIISVLPLLTSEDSKKKTVCQMCDSGEPAQGRCNECDHFVCE
QCISAHKRLRPLQHHTILSLDEIKSGKLLAMSKTPYCTKHKGKKLKLFCESCKEVICRDC
TVVDHQNH
Download sequence
Identical sequences A7ST55
jgi|Nemve1|130690|e_gw.283.23.1 XP_001625222.1.94760 45351.JGI130690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]