SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI136666 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI136666
Domain Number 1 Region: 13-177
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.14e-39
Family Calponin-homology domain, CH-domain 0.0000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI136666
Sequence length 376
Comment (Nematostella vectensis)
Sequence
ERASGSEMDEQRKQNIAYQYLCHLEEARVWMEACLKEELPETTNMEEALRCGVHLAKLGN
FFSPKMVPARKIFDKDCKHYTSKGLHFRHTDNINYFFKACDEVGLPQVFYPETTDIYDKK
NMPKLIYCIHALSLFLFKLGLAPQIQDLYGKAEFTEEQISAMRKELEKYGLQMPAFSKIG
GILESELPVDEAALHAAVIAINEAIDHQDIAGTMEALQNPNAHLVDLDRDNSDEYQVALY
DAKSTKSAQAQVKSPGSKGEEDIYDRLLTQAEIQGNVNKVNDSEAVFSINKALADEDQDA
LRKGLMNKSSRLKEVDTNHMHWYMQALLEQRNFKLEASGNGDLTHSEIQTVVAAANTQAE
AYQQSKYLQIYHFNKI
Download sequence
Identical sequences A7SXE6
XP_001623719.1.94760 jgi|Nemve1|136666|e_gw.379.7.1 45351.JGI136666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]