SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI141800 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI141800
Domain Number 1 Region: 6-78
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000222
Family Calponin-homology domain, CH-domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI141800
Sequence length 198
Comment (Nematostella vectensis)
Sequence
MSGLPREILKWIQSLDLSHPVKNTKRDFSNGCLVAEIFSWYYPQEIQMHSYDNGASLATK
MGNWSQLQTFFQRQGFGISKEVIDGTIHCKPGAAALLVEKIYTLLTNRVVKKVRTDDELD
FTDTGYQAQLPAHARSTASMAIKNNIANTELSTDPDRILCQQKAQSIINSHVEHRRKERS
DDPHRFGIKPTLGELCPR
Download sequence
Identical sequences A7T1I3
XP_001622283.1.94760 45351.JGI141800 jgi|Nemve1|141800|e_gw.608.4.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]