SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI150208 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI150208
Domain Number 1 Region: 1-83
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.2e-23
Family Calponin-homology domain, CH-domain 0.0000755
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI150208
Sequence length 95
Comment (Nematostella vectensis)
Sequence
FKDPDISTSLAVLDLIDCISPKMINPALINPDPLSDEDKLPNAQYAISMARKIGAVVYAL
PEDLVEVKPKMVLTVFASLMLCALEKSSKNKKGKK
Download sequence
Identical sequences A7T8H0
jgi|Nemve1|150208|e_gw.3334.1.1 XP_001619817.1.94760 45351.JGI150208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]