SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI156943 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI156943
Domain Number 1 Region: 1-74
Classification Level Classification E-value
Superfamily Histone-fold 1.01e-32
Family Nucleosome core histones 0.0000535
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI156943
Sequence length 76
Comment (Nematostella vectensis)
Sequence
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
Download sequence
Identical sequences A7TAG8 C3Z799
000315456|e2io5B1|148.1.1.38|B:60-135 001565048|e5bs7B1|148.1.1.38|B:36-111 001565052|e5bsaB1|148.1.1.38|B:35-110 cath|current|2io5B00/60-135 d2io5b_ 45351.JGI152385 45351.JGI156943 7739.JGI200666 jgi|Nemve1|152385|e_gw.4894.6.1 jgi|Nemve1|156943|e_gw.13333.3.1 XP_001617711.1.94760 XP_001619102.1.94760 XP_002595683.1.56174 XP_016946215.1.21709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]