SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI165235 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI165235
Domain Number 1 Region: 10-245
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.01e-85
Family Calponin-homology domain, CH-domain 0.00000772
Further Details:      
 
Domain Number 2 Region: 2147-2268
Classification Level Classification E-value
Superfamily PH domain-like 9.18e-35
Family Pleckstrin-homology domain (PH domain) 0.00016
Further Details:      
 
Domain Number 3 Region: 266-385
Classification Level Classification E-value
Superfamily Spectrin repeat 8.11e-32
Family Spectrin repeat 0.00013
Further Details:      
 
Domain Number 4 Region: 1203-1350
Classification Level Classification E-value
Superfamily Spectrin repeat 2.4e-28
Family Spectrin repeat 0.00045
Further Details:      
 
Domain Number 5 Region: 574-702
Classification Level Classification E-value
Superfamily Spectrin repeat 2.21e-27
Family Spectrin repeat 0.00072
Further Details:      
 
Domain Number 6 Region: 1524-1666
Classification Level Classification E-value
Superfamily Spectrin repeat 2.45e-27
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 7 Region: 880-1038
Classification Level Classification E-value
Superfamily Spectrin repeat 8.51e-25
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 8 Region: 787-917
Classification Level Classification E-value
Superfamily Spectrin repeat 8.9e-25
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 9 Region: 1839-1993
Classification Level Classification E-value
Superfamily Spectrin repeat 9.6e-24
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 10 Region: 1679-1784
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-23
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 11 Region: 1008-1145
Classification Level Classification E-value
Superfamily Spectrin repeat 7.08e-23
Family Spectrin repeat 0.00011
Further Details:      
 
Domain Number 12 Region: 395-497
Classification Level Classification E-value
Superfamily Spectrin repeat 9.6e-23
Family Spectrin repeat 0.00043
Further Details:      
 
Domain Number 13 Region: 1308-1457
Classification Level Classification E-value
Superfamily Spectrin repeat 1.14e-22
Family Spectrin repeat 0.00056
Further Details:      
 
Domain Number 14 Region: 669-783
Classification Level Classification E-value
Superfamily Spectrin repeat 5.63e-22
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 15 Region: 496-608
Classification Level Classification E-value
Superfamily Spectrin repeat 4.5e-18
Family Spectrin repeat 0.00024
Further Details:      
 
Domain Number 16 Region: 1444-1532
Classification Level Classification E-value
Superfamily Spectrin repeat 4.6e-18
Family Spectrin repeat 0.00068
Further Details:      
 
Domain Number 17 Region: 1999-2067
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000131
Family Spectrin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI165235
Sequence length 2297
Comment (Nematostella vectensis)
Sequence
MEQQSAARLFERSRIKVLADERERVQKKTFTKWINSHLQRVGARVNELYHDLQDGRKLIL
LLEVLSGEKLPKPSKGRMRIHNLENVEKSLVFLKKQRVHLENVGAHDIVDGNQKITLGLI
WTIILRFQIQDITIEGETTEKRSAKDALLLWCQSKTVGYVHVTITNFTTSWRDGLAFNAI
IHRHRPDLIEFEKLTKADAEQNLEQAFEVAETQLGITPLLDAEDVNVDFPDEKSILTYVA
AYYHYFAKMKTVEVSGSRIGKVIERIKENEELIIDYEKLASDLLEWIEIKIIQLGEREFA
NTLLGVQQQMLEFNQYRTQEKPPRFVEKGNLEVQLFILTSKIRANHQKPYIPPEGRGMID
INRAWERLEKSEHERELALREELMRQERLEMLAAKFDRKYAMRETWLNENQRLVAVDNFG
NDLAAVEAATKKHEAIETDIMAYEERVNAIVAVAEELHRENYHDSERIQVCKGRIIQLWE
LLLVLIKQRRVRLEKCMQLQRVFQEMINIIDWMDEIKIGLLSEDYGKHLLGVEDLLQKHS
LVEADIAAQADRVKTVNAQAEAFLHVEDEEGKTQHKPDEAQIRDHQAELEGAYNELLQLA
AARRARLEESLKLQSFYRNADEEEMWVTEKDYFVQSTDYGHDLNTAMILLTKHEAVEREM
TARNAQTKAVARNGEELLEAVPYATDTIQNRLDTIRSKWDKLHDNAAYRKKKIQENLKLQ
QFIAEYNDIMSWCDMMERIVANDDLGYDEHSAEVLVKKHHAVEEGIQGYASEVKAFHCQV
DGLGDEDKSSPEVVDRCNTLDERYSALLQQAAARRQKLQDALSLHKLNREAYIVETWIDE
RENRLDTALTVDKGMDLEECQVIEQRFEGFQQELDANERRVQLVNELGGNLIEKGHINSD
EIKETIDRLNTRWCNLRDTANQKRAKLDKALRLQQFYAQTLETKTWISEKSSLLITEEDV
TNMKDLATVMVLQRRLNNIQRDLPALEDKCTSLENDAQQLCSEYEGEPEEEIVKEKITVV
SSSWVEMKDNVKQRDEALAESGELQRFVIDLDDFQIWLRHTHNEVASEDIPNSLSEAERS
LKEHEDIKDEIDTHEPDFQKLIEDGPKWAQDESDLQQQSLKEQLDQLQSGWKDLLVLWEN
RKRLLIQALNHQLFIRDAKQCEALLGQQDLFLSKEEVGATVEAVQELIKKHEEFSKRMDV
QDEKINQMIQFAQRLANDGHYAQDKITEKAQNLHERRNANRQKLEAALQRLRDALQLQQF
IQDAEDMYDWLNEKHQVASEESYRDLSNIQGKVMKHEAFEAELQANKERLDQISESGRDL
ADEKPENKPEIDELLQKLDQKWLELAEVSKHKGSKLKDAQRQEEFNAGVQTMQEWVKELE
TVIITQEKATDLTTATRLYQKHKQLEKQINAKKERLKELDAQAADMVDAGHFDPNAVQET
KIILEEKYECLEAPLAEKGAELDQAMQFFQFDRDVDDEETWINEKEPLLQSTNYGNNLFE
VQKLQKKHQTLCAEIDIHQKHKERICNQGDELVLGYHPQAEDIERRRKELEEKWDDLKKQ
SDAYKAQLDLSLQAKQYYFDAAEAESWMSEQELNMMGDERGKDEASATEMLKRHETLEAA
IADYAETVNELGETANGLVESNHPESEQIKIRQNQIDKLYAGLKDLAEERRGKLDETLKL
YQLNREVDDLELWIADKEQVAGSQDIGQDLAHCELLIEKFRDFARDTTHIGTERVASTNG
VCDQLIGTGHSDAATIAEWKDGINESWADLLELIETRTKMLEAALELHKYYHDAKEVLAM
IQEKDNLMTEELGRDLNSVQQLQRTHQSFEADLAPLGHQVSGIQEEAGRLLGSYAGEKAS
EIQAKEDEVVQAWKNLNLRVRQRTDKLHDADDLYRFLIAVQDQMLWMNDMLKHILTYEKA
KDVSGVEVLMDQHQSRHVEIEGREESFFGVIKMGEQLLAKSHYASAEIREKINMLHRHKD
EMLLEWKKRWEHLGLILEVMQFARDAYTAEAWIMAQESYLRNENLGIDLAEVEKLLEKHG
NFEKVVAAQEERFLALERLTQFELREAQRRQEEKAQREREERERIEREERERQAAHERQQ
REEAEQRKREEEERRREEEEKKAKENGEEDITASAARDVESRPGAGEEKEDHEEEEGKME
GYLHRKPTMDGPNRKAAIRQWKQYYVILRDMELHFFKDQKSARNDHAAAHPLATLDSVCE
VASDYTKRKHVFRFRVSNGQEFLFQAKDEEDMNIWIKHVQECAQVPESPAKPSTPDRKDK
KGSGFFKRKSKNVDEKK
Download sequence
Identical sequences A7S1C0
XP_001634494.1.94760 45351.JGI165235 jgi|Nemve1|165235|estExt_gwp.C_580066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]