SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI197793 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI197793
Domain Number 1 Region: 945-1122
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.38e-21
Family Reverse transcriptase 0.0056
Further Details:      
 
Domain Number 2 Region: 873-914
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000315
Family Calponin-homology domain, CH-domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI197793
Sequence length 1678
Comment (Nematostella vectensis)
Sequence
MDIDPEIPDRENPFEPVDPGGDDGGESIPMTSTSTHDPFRHHSIDETSFIHGVDEHTPLI
RKEERMENAWDRIREKFPKMDPVKSPFTATLDEYERVVVKLKRMGGKSYRLFDAGGGLNE
KLPSSIKNNLGPSAEEIIRSNEEEVAKREEKLRKLETKRTEVPENQREGIDTQIAETQKH
PIEKPRFIALRGCTFYNRCNSLSSEGTVSDGEHIILRIPAGQYTIETLKRQIDEGLRLGE
KPISIEDSSLEAHRNVVLNEPLACLLGLKTKELEANTQHEIRMKGLEAIFIHCDLVNASS
SLKQGAPTQILAYARAEYRISPWDENPTKNNYVSFDVFITPKVKTHFVFRDIFTDSELVF
RTAKEASRWLDAPNLSYWSQALNFAMFCATAGCGVTRDMIDDSQVGSFYRFHIIFTIRRI
LNELQCPLPKDKLFSWNKNFYSEAAYQKLRTEFRTGSDFRFLGPINHGLGNVYNYDYHGL
SSSNDKYKPYGTIDQLHDEWDAAKSEDEHMNHFEIEYLKDPRTEFQAADSIKSELDKFAD
WILSYVPEPVKKTVDKRVKRLKEKIKRISGGTEGRFTPKEQQTALKGYLKTHGIAGQEGY
DPKTFIANIKPKVLELIGQQKKPIKVKFIFTCRFIKEDPATGQIDEELGYFHTEKPETVT
ESADFSSLFDTMANYLLELVEQFQKKGSGWQFDQVEYFDINIDPLEPLSRSSYIPLPSKL
VTKHAVINVRNEDDHECFKWAVTSAVYPREKDPQRLNKQMIENSEKFDWSGIEFPVSLKQ
IDKFEKQNPYTVNVFGYETKVYPLRVSERDPDNAINLLLISNDETNHYCWIKNMMRLVST
QIDKFHHTRFLCCRCLNSFRCKQSLEKHSECCGNHEAIDNFTVSFSDGRALCYLLHHYHP
ALLPLSAIRQETTLTRNPGVLDSSDSEEDEGILRDSWTESYSPGNTPHELFSNWKRTLQA
LHECNLRLSASKTIINPKTTTILGWIWSAGTLKASPHRVATLAQCPTPTTVGRMRSFIGA
YKKALSSTRVITLPRPEDFLWIVTDGALRDPGIGVTLYITRNGNLHLAGFYSAKLKGSQS
SWLPCEVEALSIASATRHFSPYLIQSHHRASILTDSKPCVQAYEKLCRGEFSASPRISTF
LSAVRKEKEKKKGVVLFRQCLAKKGGEFYDRPLQALIHPFSQAMRADHDMPTIVEYAYRR
AHCAEDDMLRIYQKHFTYFTGPNSFYPEKIISGDPPSLMQRPSKKTQTKEGTGDETEDRR
RAETMREFTREYGRGVRQANVRAKTKKLTGTLPYSLSMLPDRIETGSDDVLDFVSEARST
VTVNDTGGSTRVQVLYYKDDIVAVRHDYRRKASPYWLAVMGEEVLVIAATGRFQKNSVTF
TWLDRTDDHLKYTFDEALERFRTYRHWRSIMSEVHHIVLIAKTKIGKRSFCYLGWHMEEE
KIRRPITDCLDGERLDGEYFWSSEYNYDVGRAYKFTPRVIAEPLHQDDIGVSGEMSINEE
IPMSNMFKNLQAIASDSVEKIWPNIIEERKFIRGNHYKNHNSTGILKCQRANLKVPNQHA
GKRRILINDKYDFPWKAIDPNLPDMPEDEDVPENEDVPEDEDVPGDEDVPENEDVPGDED
VPGDEDVPGDEDVLVVLGLARPMDDKINPSLPGRCYIMATGILTSKSFRTIPKDIATG
Download sequence
Identical sequences A7RIX2
jgi|Nemve1|197793|fgenesh1_pg.scaffold_7000076 XP_001640647.1.94760 45351.JGI197793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]