SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI208593 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI208593
Domain Number 1 Region: 88-159
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000135
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 
Domain Number 2 Region: 22-86
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000105
Family Eukaryotic type KH-domain (KH-domain type I) 0.0036
Further Details:      
 
Domain Number 3 Region: 156-217
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000319
Family Eukaryotic type KH-domain (KH-domain type I) 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI208593
Sequence length 621
Comment (Nematostella vectensis)
Sequence
MYRDSGLFTRKARKAAVIQRMSTTKEIPMPAVAIAAVIGKKKKNLEYIEKMTNIRPSIDS
DQDCVILEGSAEDVQKAEHIIMDMIEPETVELKESQIGMVIGKGGNRINSIGQETGAKIY
VKDCKAHIMGTKNQKSRAKYHILRLLAEPVVSKRTGVYISKDLVGRVFGKSGEKKKRISE
QTNTFISYNLEEEMLYICGETVLQEHNARCRIKQAVLPYNNVKCSAIEGSENSMFKLVFV
EPPYPTWSGEFFEVSLVDGQQCGPSNVVGYKDLVLKKLQHLDPEKDAFEIDLWSHIGHAY
IKGIDEGDDLQYYTLNELQSHLHQDYTWLPLQGGRSSTTNSTWRVDFAEGLTERQVAQLM
RTFQDPTCRGPSNIRYDFSFFSPLSHEYGCRRIRMKAFIKKGEDEEFPIQMKGVLRHAIL
NDNLHIYLCVPSTSVLKLTIIMPSRQFDCRLNLRKSPKNLNRTPKEQEEETMLMDYLRKA
LIICETGQLQSVQLKPDVPLPDDFDLDYFRRSERFNCHYTIGEERFTMMFSREKAVHLPN
SKKDECREMLMAYVTFLISWRAFFQIDLHLHCDDWDRRLAKGDWDPDQIIKKLDSYVEFV
RYVQSKITMETEEEQAYPTSL
Download sequence
Identical sequences A7S8X2
45351.JGI208593 jgi|Nemve1|208593|fgenesh1_pg.scaffold_94000016 XP_001631894.1.94760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]