SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI210420 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI210420
Domain Number 1 Region: 12-144
Classification Level Classification E-value
Superfamily C-type lectin-like 2.62e-20
Family C-type lectin domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI210420
Sequence length 146
Comment (Nematostella vectensis)
Sequence
MWFILICFYGLIISDNCNEEGWYQNRYKCYRFFLDSHVRWEEASRVCHVHGGVMGVFNSI
DKLDFVRYHVPTLNNSISRIFVGLQKTGGVWMWGYNNLTPEAELWESGAPASQGPLGAVT
IATGRLVDVPDSGDHKLPFVCEKNLP
Download sequence
Identical sequences A7SD48
XP_001630425.1.94760 45351.JGI210420 jgi|Nemve1|210420|fgenesh1_pg.scaffold_121000039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]