SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI211305 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI211305
Domain Number 1 Region: 23-258
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.05e-80
Family Calponin-homology domain, CH-domain 0.00000841
Further Details:      
 
Domain Number 2 Region: 2193-2336
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-22
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 3 Region: 2063-2186
Classification Level Classification E-value
Superfamily Spectrin repeat 1.74e-17
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 4 Region: 1778-1885
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-17
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 5 Region: 1891-2009
Classification Level Classification E-value
Superfamily Spectrin repeat 8.16e-16
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 6 Region: 275-392
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000331
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 7 Region: 1637-1756
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000209
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 8 Region: 725-828
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000273
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 9 Region: 1565-1671
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000366
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 10 Region: 2305-2443
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000104
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 11 Region: 1381-1499
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000117
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 12 Region: 413-501
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000677
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 13 Region: 1321-1408
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000602
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 14 Region: 1210-1311
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000846
Family Spectrin repeat 0.008
Further Details:      
 
Weak hits

Sequence:  45351.JGI211305
Domain Number - Region: 621-729
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00017
Family Spectrin repeat 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI211305
Sequence length 3031
Comment (Nematostella vectensis)
Sequence
MADSEFIDFEDVFEEEEDDQGQRMVELKHNQPDHRDAVQKKTFTKWVNNRLLKVGVRILD
LYEELRDGEDLLLLLEVLCNVKLPRERGLLRFHMLQNVQTALEFLESKKIKLVNIRSDDI
VDGNPKLTLGLIWTIILYFQINDLDVEIAGEKVQDLSAKDALLHWSKKVTQGYPKVDVKN
FSSSWRDGFAFNAIIHRYRPDLVDFSKLSKTSPEANIEYAFHVAEKELNVPRLLDVEDVV
VSENPDEKSIMTYVASLYEVFPRTPTVQESLHDNEKQLKYEEYCNYAKNLVDLVNDVISN
LEKQKIPRTIQGIKELILAFNRYRITEYPDMVATRHSIKMLYKNLQVLYGPMTTWLDFPK
DCSPRELEVLWTNLVDTQESYNKSLRIELTRLEQMSQVAEKIHKEAILVDGSLDDIEDRI
KMEEQLEDSVDVQTRRKSFTTIEKSLVMFESSIKHMISGSDILVAGKYPRAEDLQARVRA
IDHRWNRIRAHLGHLANQLRDYKSVTTGEGKRMKMEVPLTQAAAPESMDAEDAAGPRGTK
KVITVTKRTYKSATGEPLETRTTVSRVTSSLPPEERVSLSFLSSDSLPSSDSGISPGSSP
QGRKIARLQFNIDKSRNKRHTLDSMLQWVREKKASLEMAEYGLDLPSTQKCLQEHHGEHD
LVIAFDDELAAAKKYEVGYESSVNTSARGITVEDPSLKPKILELHEEYVTLVTASVERMR
HLKSLVEFMSEATKELIWMNQREEPEVSRDWARADLDLADLATYGQELLLEIKDHEPHYQ
GIVAKGNGMVQSGHPAPGPIEAYLSAMSSQWWWINQLTLAFDEHLKNAQIHQQFQGDAQA
AEQKMVHFIDQLNTVYGVQSIPDKQTATSRLHKLGVELSRVYAVRTLHSAANVIRWKNST
EAAFDHEKILHDSRWERFWRERVLPADSELSHSDIPLDAFPVVRQTKLGVVVAYSLDYVK
DIFARKASEPSVAGPKERYVLLLRSPKLDTQVQLEPLFKDVVTDMLQFKQEMKQELIDYK
DIISSLQLLSKQVTPMKQRKSKLRQKTSVKAVCSYKNMQNTVEQGEEYTLFDNTEHHAWK
VASSPGEQSEVPSVCFVIPAPDLEAIDFATRLEIQYKHLLTLWRTRHSNLKQALAKEQVF
TNIKVVKSTIPHQALPQLALAGSKDVEQLLKEMQDGDQEIIGITEQLVSEQAPESTDGTA
FSRTYQTPQAMDEQKRVEQTLKELTKWLNDTHSLINTKSEETLNMDHIPTQLQEIKDLQD
ERVTTRQPQLEALQTTLTAKMDPHLQRKLETVVTKWKATTCSMDEWQKMLEFVLHVTTFI
RELSDWLHRVEIILIQQPGLTADLREVQAQLSQLESISEKEIIPRLNKIEDVQLALPQLR
ELDRAHTQDLLDRWDQVTEQVDERMRRLARGLQGLHGFQTPLAAERTWLDEAELKAEELR
SAEEHAQSVEQRMEELTNFYTEVCRHETPVKTCTTDGDDYTNESKDFEDSLERYRRSLHH
LPESREKENSALGAARRGRETIRANTAETRLRYERLMAEVQGVMEAMVDVLKKEGPEHKE
VEAACLDWCSSIQRLLDWVSDTEKTLVQQDASPADVRQLEEQIEEQKKLTRAINERKRPV
ESALKQGERFLQGRADQLGPEARGALDSKMTSLEARWNRLQNELDNRYMKLVLIHEKLTR
FEELLHPFLAWLKRAEEHRAVIMNNVNDSQTAQERLYTHKNFVEDVKDHERDLKEVNHCG
EDFLHEAKVFQAELERSVATLGDDQAPSEDLGNPNDKSWVLEKKLSDINERYNRLLVLLT
ERGTYLDRSWKQLRDYDTKASQVLPWLSSAEERLARKMAQPIGRDPSTLRREIDELKAFQ
AEVNSHQPEVISVDVLGHSIERVAPTSGKPVRQRYDELCTNIAQYEARLQSALTNSQNFK
DGLDGAIRALQEVKKHLGKLEPVSSTLAELRTQAQQFKVYQNEINKHGTTVDALNEMFQG
LKKKQKESKLKQLNKLWDEVRGMAESRRADMKSVFVMIAKDFERWELTMIKRLDSGELVT
SDILVFEEKLQNFKDEVERMRPALQGVNQGGHELLNLERTKLSVILETLDRVNKDWQTLC
VKLMNTSSKLDELQEQSEKFYNVLRIITTWLNTTEVTLVSMATVCVDPDVLGQQITQQKA
LQDEAVQYKARLDLLNGLGKVIITMSGRTDHAPAPGTHPIEQDLDAILARYDEVWKSMEA
RRFLLETTLLQMERYRRQVKSVTIFLNRAEKKQKEQDPVGCDADTIQKQISEHKTLQRDL
QKAHADMESLLKSGNELMQGRESVPGSEDVREEMDHLKSRLDHVTVTSLERQKELESTWS
AVKHFTEAVSVLDRRLKNKFDEIDMLMKAGADSMDVYKGLKRLESDLDQLTYQMTTARES
GDDMIRHLHSTHQDTTAVRDKLDDVNTKWSDFQKRLKELTEYLATKTQIAPQAGEEGTST
EPSQPEVQEVTNAVTLQDQPVTQSFEPTSEEEKVEEYVDEYGHVIRCITRRTLVIKRYIT
DDNGHKNDLPDMPPEEFPPNSEVHEFVDKNGRIVRRSDPEALDTSDIPPGCDIEELIDEE
GRTVKRVVKRHILVRVFVYNHEGQLEEIKISPEELAELSEPSWKKKPLKMSIASSKIDKE
PDSEAVGVSYPLETSEREKEFVDVHGRIIKTIITRSVIRTWIVFDEKGNHVQDTNAPESE
ELPTDCELEDVSDEQGRVVRRIVKRYIVVKVFIINHEGQLEEIEISPEEKADILESSQTQ
TTKPSVISLDEKPLKMNVVASKTPSKEVAPEKREPPQPLSQAIEVDFPLETSEQEKQFVD
VHGRIIKTIITRSVIRTWIVFDEEGNHVQDTNAPESEELPTDCELEDVSDEQGRVVRRIV
KSVAASKTPSKEVAPEKREPPQPLSQAIEVDFPLETSEQEKQFVDVHGRIIKTIITRSVI
RTWIVFDEEGNPVQDTNAPESEELPTDCELEDVSDEQGHVVRRIVKRYIVVKVFIINQEG
QLEEIEISPEEKAEILESPQTQTTKPSVIEP
Download sequence
Identical sequences A7SF38
jgi|Nemve1|211305|fgenesh1_pg.scaffold_135000043 45351.JGI211305 XP_001629771.1.94760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]