SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI212749 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI212749
Domain Number 1 Region: 88-213
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.5e-31
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000363
Further Details:      
 
Domain Number 2 Region: 39-92
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000024
Family Cold shock DNA-binding domain-like 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI212749
Sequence length 214
Comment (Nematostella vectensis)
Sequence
MSVDARLPCKRKSVASISVSEPKHIVTPGDVITEDTGYMRYNGEIGDVVVGRITEVGQKR
WKVETFSKLDSVLMLSSVNLPGGELLKHGTLVKIPPTMVKRCKTHFHNLPCGATVIIGNN
GYIFLSTIITPEALGTDGMAEPDQPDISEIRAADREMLARLRNCVVLLAHESILLFDSSL
MYAYDESLKFSVKELLKPEVIEEIGTMVRQRLQE
Download sequence
Identical sequences A7SIE5
XP_001628582.1.94760 jgi|Nemve1|212749|fgenesh1_pg.scaffold_162000012 45351.JGI212749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]