SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI214383 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI214383
Domain Number 1 Region: 132-188
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000126
Family Eukaryotic type KH-domain (KH-domain type I) 0.00042
Further Details:      
 
Domain Number 2 Region: 63-115
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000504
Family Chromo barrel domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI214383
Sequence length 477
Comment (Nematostella vectensis)
Sequence
MGLWISSSQSLTPTCLSSLSGYGFMDIGLPPASPSERDIDLKDDKSTLFLIACYARYNCP
YVWVYTRADDNEPCGWWLAKIIHKKGEFFVIQYSGWDATFNEIVPRERIRPPNTNGSISR
QMYYKLAKKQMGILERLKLPEHLMGLAIGAQGANIQQARKLPGVMSIEVDEENCTFNICG
EEVEQMKREKESLDHQLQNMGISPPTGPSYIPTPAEMRIGTNLMVAPPDSTGSTGRDRAL
TTDSYGGDLSEGMSISTDPGTTARPSTIRIRSSSESDNTESGRLNSQNANRRAPTPTSEL
TDIREEGEEHGAHKGSSGEPVKDQRKKPSPWFMSNRKRSNSEGKDDKPNGDGRQHQHNGR
SNQRPDQRSWNQGKAQARHSQQSNRSNKSSSNGTQMRSNSGSLSQNWRKQEGLKERSGSD
ETEAKPSEVAAEETVAEEKVNSEEKSSVESAEQAGKGTEKKSCDQPEAADAPISAEG
Download sequence
Identical sequences A7SM36
45351.JGI214383 jgi|Nemve1|214383|fgenesh1_pg.scaffold_199000001 XP_001627317.1.94760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]