SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI217852 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI217852
Domain Number 1 Region: 104-588
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.3e-149
Family Calponin-homology domain, CH-domain 0.00000000275
Further Details:      
 
Domain Number 2 Region: 3-65
Classification Level Classification E-value
Superfamily EF-hand 0.00000223
Family Calmodulin-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI217852
Sequence length 595
Comment (Nematostella vectensis)
Sequence
MTEMRDGFAKFAKNNKISCDDFAAVMKECSEYVPGYKLRRVVEDVKKENEGQIDFLLFLK
LFKDLSIKAAGGDFKKAVDKREGVKEVGGDSSASAEGTRHSLTDDERIGFTDWINSCLGD
DEDLKEAQDGLFNAVKDGVVMCKLINWSVPHTIDERAINMKKLNVYTIHENQTLVLNSAM
AIGCNIVNIGAEDLIEGKPHLVLGLMWQVIRIGLFAKITIQNCPGLVQLLHDHEELDDLR
RLAPEDILLRWFNFQLEDAGHHRRVNNFSSDISDAENYSVLLNKIAPPELGIDTPHVSES
DPTKLAELVLTNADKMACRKFVRAKDVVKGNAKLNLAFVCNLFNTFPCLEPVEHEMTDIE
ETREEKTFRNWINSLGIKPFVQNLYLDLDDGMILFQLFDQVQPGIVNYDKVNKPPFKKMG
AKMKKLENCNYAISVADLLKFSLVGVGGKDINDGNKMLILALLWQTMRAYTLTVLQKCAG
SEKPVTEAEIVVWVNEKLSSAGKATTITGMKDPEIKTSKCVLDLIDAIKPKAINYSMVNA
GECQEDAFLNAKYAISMARKVGARVYALPEDLVEGKSKMVMTVFACLMARGLKNK
Download sequence
Identical sequences A7SUX1
jgi|Nemve1|217852|fgenesh1_pg.scaffold_315000004 XP_001624584.1.94760 45351.JGI217852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]