SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI223262 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI223262
Domain Number 1 Region: 75-300
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000000223
Family Calponin-homology domain, CH-domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI223262
Sequence length 563
Comment (Nematostella vectensis)
Sequence
DFADAYELLNSKNVNHDRLLAYAREAADFSTKHQLPHLDFALNHQHKEDVAMFDFTSLYA
AEYSIKVYERKGYKLLATIVGDSLLEPFWPTGSGCARGFLGCFDAAWAQRSFGLGKQPMD
IIVERESTFRLLAQTTPENLNKNFDGYSINPDSRYPNFNKSSARGSALHHLYDRLEGPLD
RTDGPDMDMDTSKTSESVDLGDFNKHQTTGFLCLVYSSTRDYNIIPLSDKNLVTCLLLFR
NFDSLKPGDTETNCKLAFETAEEQLGIPPQISASEMVTSGNPDPLMIMSYISQYYESFKN
ETPAAKQDASIDNSQLSYKTKSPLSKLSILSRLSRKKEKRKSGSSGTEPVTAKKSKHAKE
NEAPRSPTSPTTPKEASTPPAQPNVQLRRQSSDDKAPMSVKAVKASNRISLLAEQVFGEN
ATKTSSRQDGKVQQIVKEESRTQKRHRKTHSAVSFPKDTVDAICEAADRKQLRAKEEPQI
KRKLEVEDGPDDQSPKESVEMEVNENPDEKFNRTRPPSSIRAKQGERVVSPKEEKEPVKP
ERLAGPSLNKRSSTEKYLSKTLA
Download sequence
Identical sequences A7T761
45351.JGI223262 XP_001620291.1.94760 jgi|Nemve1|223262|fgenesh1_pg.scaffold_2495000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]