SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI223981 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI223981
Domain Number 1 Region: 79-107
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000794
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI223981
Sequence length 116
Comment (Nematostella vectensis)
Sequence
MLHTKSSISYLGREDRKKKRKSRWGGEDKKMIIPGMPTTLPPNLKPDQQKAYLMQLRIEE
ISRMLRTGDLGIPDNPEDRGNTLKNMEKETNAKIMIRGKGSIKDGKGSFKTLLFSC
Download sequence
Identical sequences A7T8Z1
XP_001619643.1.94760 jgi|Nemve1|223981|fgenesh1_pg.scaffold_3668000001 45351.JGI223981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]