SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI224114 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI224114
Domain Number 1 Region: 309-470
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.81e-28
Family HD domain 0.031
Further Details:      
 
Domain Number 2 Region: 208-298
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000886
Family Eukaryotic type KH-domain (KH-domain type I) 0.0037
Further Details:      
 
Weak hits

Sequence:  45351.JGI224114
Domain Number - Region: 28-66
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.0105
Family F1F0 ATP synthase subunit B, membrane domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI224114
Sequence length 520
Comment (Nematostella vectensis)
Sequence
MDIVSIIIGIFVGIGVGFGIAKFLEKSNVSTLIKNAKKEASSILKDAKAEAESIKKDKIL
QAKEKFLELKTEHEQVILSRDKKMADAEKRTRDKESQISNELAKTKRLNEDVDAKIADYN
NRIDFLEKKQQEIDKLHKSQVEQLEVISGLSAEEAKNQLVESLKAEAKTSAMSFIQTTIE
ESKMTAQQEAKKIIINTIQRVGTEEAVENCVSVFNIESDDVKGRIIGREGRNIRALEAAT
GVEIIVDDTPEAIILSCFDPVRREIARLALHKLVTDGRIHPARIEEIVAKTQKQIEEEII
EVGKRTVIDLGIHGLHPELIKIVGRMKYRSSYGQNLLQHSREVANLCGIMAAELGLNVKL
AKRAGLLHDIGKVPDTESELPHAILGMQWAEKYGEKEEVCNAIGAHHDEIEMKSLISPII
QVCDAISGARPGARRQVLDSYIQRLKDLEDIAFGFSGVKNAYAIQAGRELRVIVESEKVS
DEMASNLSFEISQKIQTEMTYPGQVKITVIRETRAVNIAK
Download sequence
Identical sequences A7T9B7
45351.JGI224114 XP_001619510.1.94760 jgi|Nemve1|224114|fgenesh1_pg.scaffold_3956000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]