SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI232687 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI232687
Domain Number 1 Region: 67-120
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000019
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 2 Region: 2-60
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000292
Family Eukaryotic type KH-domain (KH-domain type I) 0.0043
Further Details:      
 
Domain Number 3 Region: 124-188
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000121
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI232687
Sequence length 252
Comment (Nematostella vectensis)
Sequence
MGMVIGKKGRMLEEIKHKTRVRPIIDKSRHGCIILQGSRTDVQKAKRMIEDIVESIQQPE
VISLGAKTSRVIGEGGRSINSIRSQSEARIHIKEDKAYIRGTQEQKSKAKDLINKLLTSV
SSGTCVFIPEHLARHVIGKHGQRIKDLKQKTKTDMYYNKENNILCINGVTTAQEHHARRK
VKSIMLQSHGTYMNEKYCVVDGSKESEFELESVATPFPGWSGAFYKVVLPDDDMSSSNEM
NELPVSFIIQLL
Download sequence
Identical sequences A7S4R1
jgi|Nemve1|232687|fgsh_est.C_scaffold_73000006 XP_001633431.1.94760 45351.JGI232687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]