SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI233472 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI233472
Domain Number 1 Region: 20-101
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000143
Family Snake venom toxins 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI233472
Sequence length 125
Comment (Nematostella vectensis)
Sequence
MKAALWIAVFLCVALSTVVSIECKYCWPAMDREKCRASEKTINCREYKSMDYNSCIEVIY
HGNHTIARTCYQGLKCGDARIDCMLQGPCEVKCCQKNFCNTAGKSSVSYALMATITSLSA
YLSLA
Download sequence
Identical sequences A7SQI9
45351.JGI233472 jgi|Nemve1|233472|fgsh_est.C_scaffold_240000006 XP_001626132.1.94760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]