SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI239614 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI239614
Domain Number 1 Region: 350-585
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.25e-74
Family Calponin-homology domain, CH-domain 0.00012
Further Details:      
 
Domain Number 2 Region: 1566-1667
Classification Level Classification E-value
Superfamily E set domains 1.27e-33
Family Filamin repeat (rod domain) 0.0000463
Further Details:      
 
Domain Number 3 Region: 1085-1191
Classification Level Classification E-value
Superfamily E set domains 5.47e-33
Family Filamin repeat (rod domain) 0.00021
Further Details:      
 
Domain Number 4 Region: 982-1095
Classification Level Classification E-value
Superfamily E set domains 7.01e-33
Family Filamin repeat (rod domain) 0.0000955
Further Details:      
 
Domain Number 5 Region: 1843-1961
Classification Level Classification E-value
Superfamily E set domains 9.34e-32
Family Filamin repeat (rod domain) 0.00045
Further Details:      
 
Domain Number 6 Region: 1469-1574
Classification Level Classification E-value
Superfamily E set domains 1.27e-31
Family Filamin repeat (rod domain) 0.00049
Further Details:      
 
Domain Number 7 Region: 1747-1864
Classification Level Classification E-value
Superfamily E set domains 1.91e-31
Family Filamin repeat (rod domain) 0.00022
Further Details:      
 
Domain Number 8 Region: 2777-2870
Classification Level Classification E-value
Superfamily E set domains 9.34e-31
Family Filamin repeat (rod domain) 0.0000519
Further Details:      
 
Domain Number 9 Region: 2985-3077
Classification Level Classification E-value
Superfamily E set domains 1.2e-29
Family Filamin repeat (rod domain) 0.0000742
Further Details:      
 
Domain Number 10 Region: 785-903
Classification Level Classification E-value
Superfamily E set domains 1.44e-29
Family Filamin repeat (rod domain) 0.0011
Further Details:      
 
Domain Number 11 Region: 2060-2152
Classification Level Classification E-value
Superfamily E set domains 2.67e-29
Family Filamin repeat (rod domain) 0.0000659
Further Details:      
 
Domain Number 12 Region: 1192-1285
Classification Level Classification E-value
Superfamily E set domains 1.67e-28
Family Filamin repeat (rod domain) 0.0000472
Further Details:      
 
Domain Number 13 Region: 3176-3268
Classification Level Classification E-value
Superfamily E set domains 1.73e-28
Family Filamin repeat (rod domain) 0.0002
Further Details:      
 
Domain Number 14 Region: 1284-1393
Classification Level Classification E-value
Superfamily E set domains 1e-25
Family Filamin repeat (rod domain) 0.00055
Further Details:      
 
Domain Number 15 Region: 3094-3189
Classification Level Classification E-value
Superfamily E set domains 2.8e-23
Family Filamin repeat (rod domain) 0.00038
Further Details:      
 
Domain Number 16 Region: 908-1004
Classification Level Classification E-value
Superfamily E set domains 3.08e-23
Family Filamin repeat (rod domain) 0.00053
Further Details:      
 
Domain Number 17 Region: 1370-1479
Classification Level Classification E-value
Superfamily E set domains 3.14e-23
Family Filamin repeat (rod domain) 0.0018
Further Details:      
 
Domain Number 18 Region: 1660-1768
Classification Level Classification E-value
Superfamily E set domains 2.59e-22
Family Filamin repeat (rod domain) 0.00025
Further Details:      
 
Domain Number 19 Region: 3273-3367
Classification Level Classification E-value
Superfamily E set domains 3e-22
Family Filamin repeat (rod domain) 0.00013
Further Details:      
 
Domain Number 20 Region: 2903-2999
Classification Level Classification E-value
Superfamily E set domains 2.07e-20
Family Filamin repeat (rod domain) 0.0011
Further Details:      
 
Domain Number 21 Region: 595-696
Classification Level Classification E-value
Superfamily E set domains 1.4e-18
Family Filamin repeat (rod domain) 0.0014
Further Details:      
 
Domain Number 22 Region: 1970-2058
Classification Level Classification E-value
Superfamily E set domains 4.4e-18
Family Filamin repeat (rod domain) 0.0011
Further Details:      
 
Domain Number 23 Region: 2711-2790
Classification Level Classification E-value
Superfamily E set domains 0.000000000000012
Family Filamin repeat (rod domain) 0.0016
Further Details:      
 
Domain Number 24 Region: 2162-2253
Classification Level Classification E-value
Superfamily E set domains 0.000000000000113
Family Filamin repeat (rod domain) 0.00065
Further Details:      
 
Domain Number 25 Region: 2268-2330
Classification Level Classification E-value
Superfamily E set domains 0.0000000000058
Family Filamin repeat (rod domain) 0.0015
Further Details:      
 
Domain Number 26 Region: 2338-2427
Classification Level Classification E-value
Superfamily E set domains 0.00000000000934
Family Filamin repeat (rod domain) 0.0019
Further Details:      
 
Domain Number 27 Region: 2428-2508
Classification Level Classification E-value
Superfamily E set domains 0.00000000014
Family Filamin repeat (rod domain) 0.0011
Further Details:      
 
Domain Number 28 Region: 2626-2688
Classification Level Classification E-value
Superfamily E set domains 0.000000000234
Family Filamin repeat (rod domain) 0.0014
Further Details:      
 
Domain Number 29 Region: 2519-2601
Classification Level Classification E-value
Superfamily E set domains 0.000000000447
Family Filamin repeat (rod domain) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI239614
Sequence length 3367
Comment (Nematostella vectensis)
Sequence
MEARTFYLSEDADDVFLQSAFVEKPLQSVPHGQQALRRESDPHTQERPGQSSQQAVGRAI
DSYATPAEQRFPQGTHEQNGGLRNGVNTATARKEYDFYASQDLDPLPPPPPPLLDESGSS
PFDDRSRDDDRWRSRAADNAQWSRGADDRHWSRGDEDRHWSRGDDDRQWSRGADDRLWSR
GDEDRQWPRYYNSHALTHDGRYLNTEQTNPLPRRSKSLTSFNDDGDYGLAAFPIANRTQD
DSVRSSNGSGRSSVQANGVLARSKSERAIESEDVVCKVGTPVLRSQSWKDIRDEWSEEGN
QVAKGGKKINNGLAKNYKRFINQGSNSQTKVRTMASEPSNYRKSADFDFNMPDTDPTAAD
AEWKKIQQNTFTRWCNEHLKCVKQFVYSLETDLCDGLKLIALLQVLSQKRLPRFNKKPVF
KSQKIENVSISLKFIEDENIRLVNIDASDIVKGNLKLILGLIWTLILKYQISMPYLDDDD
DENHKMTPKQALLAWVKSKMPESVPMDNFTTHWNDGRAIACLVDAVAPGLLPECEDLDPK
DALQNAQQAMKLAQDWLDIPQVLDPADMVNPKVDELSMMTYVSYFPEAKLKPGAPLRPRV
HPASRCHAKGPGIEPKGNVAKRPADFTVFAQGAGLGKLGVQVYGPGKTEQEVVVKDNEDH
TYSCRYVPNTPGKRYVSNTPDKRYLSNTPGKRYVSNTPGKRYVSNTPGKRYVSNTPGKRY
VSNTPGKRYVSNTPDKRYLSNTPDNRYLSNTPGKIYVSNTPGKRYVPNTPGKRYVSNTQG
KYDVHVKWNGRHIPKSPFRVEVSSDLDAGKAYAKGPGLAPTGVVAGKYTDFTVFTAGAGE
GKVSVKVIDPRGGEDVDVIIEPQDNQEFLVEYQPVNTGKHTIKVGYGGQPIHGSPFHVMV
SPPKVDPIPSKVKVFGAGVEPTGLKAGMRAPFTVDTRGAGDGELDVFVEGPLGEEKVDIK
NNNDGTYSCIYFPSKFGKYVVSVTWSGEQAAKSPYEVKVATAVDASRIKAYGPGLERGIA
NKPCHFTVETKGAGVDSLGFAIEGPAQAEIKCVDVGDGKCEVTYYPLVPGKYAVHVTCGD
VDIKNSPFMVPISPAGDASKVYAKGPGLEPEGVCAGCPAEFTVYTNEAGDGDVDIKVMDS
QGKKSPSEIKDNKDGTYTVTYYPDKPGMHTVAVHFNDKPIPKSPFKVNICSTNTSKCRAY
GPGLEKGFVDQRNDFKIETKGAGEGGLGLTIEGPSEAKIDCIDNGDGSCDVHYWPNEPGD
YMVNILYADKHIPGSPFKARISHPFDPSKVKVEGPGIEPGICVGDPADIDIDTRLAGDNL
LEVKVVDDLNQPVKCDIEEEEYGMYACTYTPEKDVPHRVNVTYGSKHVPGSPFKVPIKPA
GDSSKVKVAGPGVAPTGVNPGKPTWFTIDCKDAGKGDVHVTVEPAAKGGKPVEKITVAEV
SKDNYKCDYIAPAEGPYNVKVSFGDKPAPGSPFRVNVAKAGNAGKCKAQGDGLETAIINQ
LAEFDVDCSQAGEGQLMASVTNPSGAHTDTLITDNQDGSFGVSYTPFEEGIHDLAVKFGD
DHIPGSPFKVDVLPVTDPSKCKAYGPGLQHAQLNKPADFTVETKGAGAGGLSLAIEGPSE
AKLTCQDNGDGTCSVSYIPVEEGDYDIHIKFADEHIPGSPFTAKAGRPVDPSKVKCHGPG
VDRVNPLFSKTPQRFTVDTTEAGVAPLDVSVETPNRQTIKPDSVVEEKPGIHAVTYTPED
EGRYKVNVKYASTHVPNSPFNVRAGPPFDASKVKVSGPGVDETPYTCEPVEFLCDCSEAG
TAPLGVTVSPPSGPDLKPDVKDNGDGTYTVAYVPDKPGRYNIDVKYGDRRVPRSPFRPTV
KPSGDASKVKVKGLGPNEKVMTNQENDFLVDARNAGKGTPVCTCIGPNKKDVPVDVVPNK
DGTYSCYYTPEDEGRHSVDVKFAGDNVPGSPFLVKAEKGLDFDKIKCAPRNPVDEPPVNK
ELVYAVDAAAAEPVPGQGLVNGSLLTPSGKKEPVKVRNNKDGTYDVACVPKTPGPHELTV
KYDDQPIPGSPFKFNAVEGGPGAVKAFGKGLERGLAKEPCEFTVVTRDAGPGGLSLAVEG
PSKAEIKCQDNGDGSCNVTYVPDEPGEYNINVKFADKHIPGSPFLAQIYNTWDDLDAAKP
RPTVGKPCDVGLDIPDLPPDVSVLKGTLKRPSSNKEEPIEIRINDDDSLGITFVPYEPGE
HLISIKKNGRHVQNSPFSVMVQAQRIGDVYPVGHTADVGIPGLEDFGDLRKLTATLRRPH
SNAEESVHLHKNPDNSISCSFLPREPGEHFLTVKKDKQPIPGSPFSILVEAEEPIEAVGC
PVDYCFDIKDDVNLPDELDKLKATITRPNTDKEEPVGLKLNSDLSLSCSFIPRETGMHLI
HIRKNGRDITGSPFPLNVTAPEAVSQVGRPYGLGLDFDGVNPCDDYAHLTATLKRPSSNK
EEKLNLLLNGDNTLGVAFTPREVGEHLVHVRKDGCELPESPISIMVVGKDEKVEEVHPVK
KTCDLSLDIPGVTLPDDFKKLSGSLKRPTSDKEEPLTLTLNKKDNTLGVSFVPVEPGEHK
IRIKKEGKDVPGSPYSVMVEAAEAVNAVGKPCDCCLPGRFDEDDLRRLNATLKRPSSRTE
EPLKLKLNSDKTLSAVFIPNETGEHIINVKKFGRHIDGSPFSVMVVAPEANAIGRPCGVG
LEIPGLRLPEDFDLLTGSLRRPSKTCEDSLNLTLNSDNTLSVSFVPQETGEHFVSVKKSG
KHVTGSPFSVMVSGPGPADASKVKVTGDGLRKGVTGEPARFTVNTRDAGYGGLGLSIEGP
SKAEINCVDNEDGTCSVDYLPTEPGKYTINIKFADEHVPGSPFKANIRRPGEEEIVAMSE
DGVESEPTQRVSQVFEDLVSFGAAAPQPHDFVFDLKGYNVEDLETTVISPDGEVLPAEIV
ESGTNSYTIRFMPKESGEHVINVKYRGRHISGSPFKVYVEAPVWGGAAKCTAAGPGLERG
VVGHPGDFTVWTRDAGPGGLAIAVEGPAKAEITCHDNGDGSCNISYLPTAPGEYTIHIRF
ADEDIPGSPFKVFVTTEVEDRFRDLKLSDLESSGLKVGQPASFSVQTNAPVGKVSATVIA
PSGTESKAVISDLGKGNYAIRFVPKEFGDHLVNVKFDETHIPGSPFKIRVGGGGAHPEKV
KAYGPGLSSGHAGKSAEFTVNALEAGSGALALSVDGPAKVKMNCTENQDGTYQVTYYPVV
AGEYTISIKFAGQHIPDSPYNVTIFPPSGHLQHSEGDASKCTSRGTGLHRAVLGQPNSFT
VNASNAGRGSLMVGVEGPAIPAKEINVKHTGSNVYAVNYALEEPGTYILKVLWGEKHIPG
SPFHVTV
Download sequence
Identical sequences A7RNL3
jgi|Nemve1|239614|estExt_fgenesh1_pg.C_170047 XP_001639010.1.94760 45351.JGI239614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]