SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI240553 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI240553
Domain Number 1 Region: 29-250
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.46e-58
Family Calponin-homology domain, CH-domain 0.00027
Further Details:      
 
Domain Number 2 Region: 1409-1516
Classification Level Classification E-value
Superfamily E set domains 2e-27
Family Filamin repeat (rod domain) 0.00056
Further Details:      
 
Domain Number 3 Region: 1344-1434
Classification Level Classification E-value
Superfamily E set domains 5.47e-23
Family Filamin repeat (rod domain) 0.0022
Further Details:      
 
Domain Number 4 Region: 636-732
Classification Level Classification E-value
Superfamily E set domains 3.94e-22
Family Filamin repeat (rod domain) 0.0015
Further Details:      
 
Domain Number 5 Region: 453-548
Classification Level Classification E-value
Superfamily E set domains 5.74e-19
Family Filamin repeat (rod domain) 0.0019
Further Details:      
 
Domain Number 6 Region: 558-646
Classification Level Classification E-value
Superfamily E set domains 4.6e-18
Family Filamin repeat (rod domain) 0.0021
Further Details:      
 
Domain Number 7 Region: 1225-1324
Classification Level Classification E-value
Superfamily E set domains 1.07e-17
Family Filamin repeat (rod domain) 0.0021
Further Details:      
 
Domain Number 8 Region: 361-463
Classification Level Classification E-value
Superfamily E set domains 3.74e-16
Family Filamin repeat (rod domain) 0.0033
Further Details:      
 
Domain Number 9 Region: 267-354
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000000122
Family Calponin-homology domain, CH-domain 0.0011
Further Details:      
 
Domain Number 10 Region: 826-919
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000267
Family Filamin repeat (rod domain) 0.0058
Further Details:      
 
Domain Number 11 Region: 1029-1111
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000434
Family Filamin repeat (rod domain) 0.0046
Further Details:      
 
Domain Number 12 Region: 751-829
Classification Level Classification E-value
Superfamily E set domains 0.00000000000024
Family Filamin repeat (rod domain) 0.0042
Further Details:      
 
Domain Number 13 Region: 940-1017
Classification Level Classification E-value
Superfamily E set domains 0.00000000000494
Family Filamin repeat (rod domain) 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI240553
Sequence length 1542
Comment (Nematostella vectensis)
Sequence
MSVQMRERTHSGGSSSSVKRSSINLRSSQYIAHEEKDWIEIQKNTFTNWCNEQIRESGIV
ITDLAIAFNDGVTIVYLVESVAEKKCKNCKMNPKFVQDKLENTTQALKLLENDGIQLVNI
DNQDIVNGNLKLIMGLIWRLILHYQISSSASASGKQLLLLWLKNALPELKIGNVTTDWNS
GIALAALINFCDPRLMTDWREMNPDNSIANVKKAMKCAEDNFRIPQILSPELFASPYVDE
LSMMTYLSFFTQPGSPGERKTLEIVNKSAPGIHVRNFNTDWNDGRVIVQYLEEQCPGMIS
ENVDEMTPVERVEVAVTNAEEKLGVKKVVTAKEMTSPDVDELSVMAYMLSFQNCEKLRSH
ASSFTAEGTGIRRALRGRSSDFQVFGRRDLGIENARVEVQGPHGEKIPVTVKQTLDGLKC
SWTPQTAGRHKVSITHVGEHLPDSPFYVDVLEDVSDTQVSGQGLKNAVILKPAEFIIRVH
GSSEANVTATAEGPSNAVPVNIVRNRSDGSYVARFTPREVGEHRITVMVGATPLPGTPFV
TKVGDPSKVIVTPAESMRSPVLGEPVKFEVDTTSAGLGELAIKCKGPTGGIPVDVRATAR
GKYQVSYLPNTPGDYVTHCTFNGEDVPESPLRSVAGDPDKIVAHGDGLYQVEVGSPGEFF
ITLHGAARGGLEVSGDGPNGHFPVELVESSRDNDTYTVRFMPQGVGIHKIHIRYNGRPVR
GSPFLVKVSDASKVRLSKNVHTSGRGHVIRHEVDVPLEVPREAGEGELSATCVGPDMESV
ATSVTKERDGNHHIRFMPNRSGIYTLSVFYGGREVTNSPLRLRVGDPSSVRLRESVRQST
VYNTMTEVDVPIDVEDDVEEITAAVHGPNDQFVKSTLSKENDGLYHIRFMPEQPGRYTVD
VLCEGYHIANSPLIMSIEDSKPVQVKLREFEKQETIRYRVRQEVDVPMEIPSQVTEVSAE
VRGPSNEHVLSTFRKEPDGYHHLRFVPYSKGTYKVDVRCKGKSVEGSPFSMNVGDPSSTL
VRLREADPIESQYMVSRELDIAMDIPDDHWEVTSEVRGPDEEIFPSSIGKGEEGCYHVKF
IPNRPGTYKVHVRCDGEPVENSPFLIKVGEPEPVQVAHVRSEELFAERIIQNEVDLTVET
TSGAEGGYFTANVTGPDESDVFVRYQNQLVEGAPFLVNVTEQTRAVMTIDRNEKFYQYSE
VECPMDVPVGTHPNELNVQLYDPESKPMKYTVVRGRDSSQCFIRYCLVNERTEFNVDARK
GGDGVLTATLSGVKHQSDVEIQERNDSHYNCHYTAPYAGAYILHVRWDGRDIKDSPYKVT
IRDRQSDQVAVDGPLTRSDYVTYTNTVTTFTIRALEGSGPLYVRCAGPTQDCDVNVQDNQ
DGTYAIKVYPTEVGTHLVYVEWGGRSVEGSPFMFRVGQTGDPSKVRVYGPGIENGLRYNF
KGHFLVDTKGAGPGTLKIRIHGPKGAFKVEMYRDTTKDRTIGVRYNPTEAGRYTVNIRWG
DEPILGSPFEVNIVETQQELDQLNELQDNHVTNRRLSDTAHL
Download sequence
Identical sequences A7RTE6
jgi|Nemve1|240553|estExt_fgenesh1_pg.C_310029 45351.JGI240553 XP_001637317.1.94760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]