SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI243140 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI243140
Domain Number 1 Region: 6-83
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000241
Family Calponin-homology domain, CH-domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI243140
Sequence length 264
Comment (Nematostella vectensis)
Sequence
MSGLPREILKWIQSLDLSHPVKNTKRDFSNGCLVAEIFSWYYPQEIQMHSYDNGASLATK
MGNWSQLQTFFQRQGFGIPKEVIDGTIHCKPGAAALLVEKIYTLLTNRVVKKVRTDDELD
FTDTGYQAQLPAHARSTASMAIKNNIANTELSTDPDRILCQQKAQSIINSHVEHRRKERS
DDPHRFGIKPTLGELCPRSAPRPSHHLSRNTEENFQQKQTSEQELSFSGEPPAHYTEVQV
NQLPNGSDNIMHSTHSGALYNMVH
Download sequence
Identical sequences A7S652
jgi|Nemve1|243140|estExt_fgenesh1_pg.C_800025 45351.JGI243140 XP_001632822.1.94760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]