SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI243586 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  45351.JGI243586
Domain Number - Region: 198-236
Classification Level Classification E-value
Superfamily UBA-like 0.0403
Family CUE domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI243586
Sequence length 239
Comment (Nematostella vectensis)
Sequence
MSNTYVSRPSAARRSRKADLTHPGDGDADDPTSSQQTPQQQPLPRVERREAYTMIRPDEK
KREKILQVARTEEENAHKRKLNKQTTPIKITPRPLGGGQSSEQEAKLRLQRENERKTRQK
ALEVKKKREEYRKKEKEREDEEITKKKALAREQAEKNARKDSLKKEEMRRHNVEYFESKF
SGMNTQTQEDCSTSVGTLTGGLEQLSRRYPSYAPDYLSGMLISCGGSVENVIDLLDSIQ
Download sequence
Identical sequences A7S8K0
XP_001632065.1.94760 45351.JGI243586 jgi|Nemve1|243586|estExt_fgenesh1_pg.C_920058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]