SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI244220 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI244220
Domain Number 1 Region: 15-127
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.11e-28
Family Calponin-homology domain, CH-domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI244220
Sequence length 135
Comment (Nematostella vectensis)
Sequence
MTDSLPTTQNTKLKIGAKWDDEVVSDVCAWITKMTGDSLAHGDQDEFAKSLKTGTTLCKL
ANAIQPGVIKKPHLNPGKMGFKMMENIGWFVNFIKSYGVQEEYIFVTVDLYEKRNVWGVV
LALRALKDKVAEKSG
Download sequence
Identical sequences A7SC03
XP_001630814.1.94760 45351.JGI244220 jgi|Nemve1|244220|estExt_fgenesh1_pg.C_1140012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]