SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI244226 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI244226
Domain Number 1 Region: 631-716
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.49e-25
Family Calponin-homology domain, CH-domain 0.00065
Further Details:      
 
Weak hits

Sequence:  45351.JGI244226
Domain Number - Region: 391-431
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000321
Family Calponin-homology domain, CH-domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI244226
Sequence length 721
Comment (Nematostella vectensis)
Sequence
MRWSKALFVFTATYACIWFLANGICRSMQFLDCVEDKYLNGSSIRKFTSSTPNVCEINCF
NEIACLSYNIGPIDLSGNRECELNFAETSSGSRLETREGFEYCQALVLITLNDLKNQVAT
QGRANHNQWVKEFEFVYRRTLNEQWSEYIEDGIVKQSPYKAIISQVSKENLKTSKFIMSK
KPNAKGCSRSIKDILSYSSDVIGNAGGNVITLRFSGDGRKTTKKLGSVMTTFCFPAENSV
KRSPEREYCISIYDGKESYDILKATLRGVFDEMKALGRTGILVNGLEYTIDWGGGCDHSF
DNIASKSPKSPFYRELEGKGSESSLALRMGACHVSIIYSFVTQSQYRHQLELIRLCLWLY
VKQSPYKAIISQVSKENLKTSKFIMSKKPWPMDRAKVVRMWIEGKTSCNFGGDTADDFQN
TLKSGVVLCKTRSRVESYFAKHAQERSSTLQVSVTTYMRVRTRSRAESYFAKHAQERSST
LQVSVTTIYMRVRTRSRAESYFAKHVQERSRTLQVSVTTICVSEHAQERSRTLQNTLKSG
VVLCKTRSRAESYFASVTTIYMRVRTRSRAESYFAKHAQERSRTLQASVTTIYMRVKTRS
RAESYFAKHAQERSSTLQVSLPYICVSEHAQERSRTLQNTLKSGVVLCKLANAIQPGAIK
KINNAKMNFMMMENIENFCNFVQTKGVASQYQFVTIDLFEGKNMHQVLITLNDLKNQTEK
L
Download sequence
Identical sequences A7SC13
jgi|Nemve1|244226|estExt_fgenesh1_pg.C_1140030 45351.JGI244226 XP_001630790.1.94760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]