SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI245986 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI245986
Domain Number 1 Region: 318-414
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.84e-18
Family Tudor domain 0.00068
Further Details:      
 
Domain Number 2 Region: 181-253
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000614
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI245986
Sequence length 500
Comment (Nematostella vectensis)
Sequence
MRLKAKMLATLAIPAAALTMVLVFLWKRKPPSNLPREEPCSEEKKDRTELSFPFNSPDHC
NKKVQEIEAKSSDELSISEVREEEIVREISERDVVENNVFTGEEDERVAQGKPELQENCQ
LSSSDSQSTQHDSGIDTKSFQDMNGSFDDTQSEGSVDSAMLASFTEVQPEAGGKYTTDKE
IWEIEFPQILCGRLIGRKGKNVKAISDQSGAKIRLIPQSPGEVSTHRIISLSGDSSQIKS
ALDSIHDRFPTVPLTRINLAATSLQAGAATPQFVNTSPAVPCVQTVLPSMVNVSVVVTSV
IDAHHFFIQLHNDLVQRQLQQLHQTMMQCYGQGLGPVVNQPIMVGTYCAAPAYTYNGWYR
SQVLGPTASPDEVEVKYLDYGGYSRIAASSLRQLRSDFLSCLPFQAVECYLANVAPLQGD
SYSSVASAVLEDLTMNAVLTARVVGQQNQLPCLELYLLQNDQSFLVFDFRINWRSCRCRN
NVALINTIIVAKALGRLVYL
Download sequence
Identical sequences A7SL88
XP_001627630.1.94760 45351.JGI245986 jgi|Nemve1|245986|estExt_fgenesh1_pg.C_1900015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]