SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI247556 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI247556
Domain Number 1 Region: 73-149
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.28e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Domain Number 2 Region: 426-498
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000321
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 3 Region: 314-394
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000012
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 
Domain Number 4 Region: 156-254
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000014
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI247556
Sequence length 853
Comment (Nematostella vectensis)
Sequence
MDFEGHDDNQMVVPGMPSIQYADGGMHAGEFTYISPEENMAGGQSPPGHDDGREAKNGGA
KHKPRGARGRPMKEADYSIRMLIPCKMVGAVIGTSGNKIKKITEATNTSIDIHRKEDRRE
VDKLVTIRGSPQDCSNANMQIHQLMREETDANLRSNEVEMRLVIHDSHAGRIIGRKGNNL
KSVMDETGASSIKVSGNTGDRMGHSSMLNPGDRIVSIKCLIHDESDGEKAVDEDEAFENC
MKAECMISGKVHECLKKDMDDLVRSKQMQQPFYQQQMHWNQGQGYGGGMPPAHMMPDNAG
GMMNVSQYPYQQAPQQFHQHVSQPIRARLAIPQKYAGAVIGTKGSFCNYMKTLSGASRVH
VSPDDKSGERYVEVIGHPMAQYFAQHCVYCKLAEQGYSNSDGELKLRAEVTVPIKGAVRG
NKEQQTNIIGKIIGKGGQNVKNLEKETRTYIKIVTDEQDPDPKEAVVQIVGSFASSQHAQ
YRINEIVNQCQQGGPMNNYQAWLGSLFSHPPWYDFLFKPGTDGIRRKDVERQKSEEDKGS
LLGANTEICHSSCHCQGCQSQIEGDDTPVAAREVADSCETIQDDNEQAIHTSKKTKRWKR
LQICDNVDTLSDSVVLNLTPKKDRTSIQGVMSRLYEVTVVDESGNALIRYYDEEELCEAE
GAESVDEVFARYRQDQQCALEIQCASGKSTYLKGFVELTPDLKEVARRKRSSFFQKQTLA
YLDEGTNDSDSVEESEEDAVSEKEEEHGDERLSEEGDSLCCDETPEEAAIDVAHTEREEE
QPDECDVTLQAQTPVYDHAQTTARSPCIVVKKSPSFRRKKKDLRWIKRQEKKRGMRTHAM
LMTLLIMNTLSVS
Download sequence
Identical sequences A7SUX0
45351.JGI247556 XP_001624583.1.94760 jgi|Nemve1|247556|estExt_fgenesh1_pg.C_3150002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]