SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI248472 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI248472
Domain Number 1 Region: 314-476
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.18e-30
Family DBL homology domain (DH-domain) 0.0000716
Further Details:      
 
Domain Number 2 Region: 17-149
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.02e-28
Family Calponin-homology domain, CH-domain 0.00078
Further Details:      
 
Domain Number 3 Region: 660-756
Classification Level Classification E-value
Superfamily SH2 domain 3.37e-24
Family SH2 domain 0.00069
Further Details:      
 
Domain Number 4 Region: 209-313
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.84e-22
Family DBL homology domain (DH-domain) 0.00062
Further Details:      
 
Weak hits

Sequence:  45351.JGI248472
Domain Number - Region: 520-547
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000663
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI248472
Sequence length 983
Comment (Nematostella vectensis)
Sequence
MAASRMRTASALSSSGRDVEEWKMARDWMISIGVLPAHGRVTDPNFTLFDFAQSLRDGVL
LCQVANVLHPGAVVDVGMKPQMSQFMCLKNIRNFLTACTRLFNLADGDLFDANELYDVSD
FGKVVNTLSKLSHLPESLHRGFEPFPPNTNKFAAYQDEDIYSNLEEIALSRDITEEENPY
DVVTIEEEGDKIYEDLCAVNYIPKPSRQSSQEEKRKYIVAEIIETEKGYVEALRMIVHNF
INDPRVKNTLNAEDKELIFINIEELHKMHSKFVFKLEDACNRMDGVNISKLFLDCRDDFL
KYGNYCARMPDAQVHELHKMHSKFVFKLEDACNRMDGVNISKLFLDCRDDFLKYGNYCAR
MPDAQVHIDELSRRDAKFKDILEECQKRANSKFTLRSLLVVPFQRVLKYPLLLSIVPGIL
IDLFLQELYKQTKPTHQDKQGLEKALCALQDVATYINQVKRDDENMKTVKDIQNSLTSGV
FLHGWSMRGETMEAERNSCSMFTKTADMKDKWITEIKRAMGLVNQGYKCVICDASCHQGC
ILKCPECRGNRRPNKSFTGVSPFMPRSPISLASISPERQRKVSAPPRMGTDAQVVVAIQN
FHGIAPSGRSSLNMVIGDEGLSIRTGTTGYFPRSHVTSTENADAGNKQNQGLSIRTGTTG
FAGKMDRTEAEQETMGRSDGTFLVRESANRAGEYALSVRFRNATKHIKIPYEDGTFCLTQ
SKVFDSIPELVAYYRENTLGVSFTGLDTTLRCGLNEDQDNREVGWRTEVSWRTEVSWRTE
VGWRTEVGWRTEVSWRTEVSWRTEVNWRTEINWRTEVSGRTEVGWRTERLVGVQRLVGVQ
RLVGVQRLVGVQRYWLGDSFVPIPGEERQGNINTEKFENFNSKQRRFLVERRVRWTDWVF
PVQLCEGVATYLYIYRIDANGDQVPKCAGIRQGFKPAVDTGCSVANSRTFLGNKKDLNQT
QPSPLAHRTQASHPRRCHRGHLT
Download sequence
Identical sequences A7T185
45351.JGI248472 XP_001622381.1.94760 jgi|Nemve1|248472|estExt_fgenesh1_pg.C_5820005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]